GBG11_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG11_MOUSE
• UniProt AC: P61953
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
• Gene Name: Gng11
• Organism: Mus musculus (Mouse).
• Sequence Length: 73
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (By similarity)..
• Protein Sequence: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70	Methylation	PFKEKGSCVIS---- CCCCCCCCCCC----	4.25	-
70	Farnesylation	PFKEKGSCVIS---- CCCCCCCCCCC----	4.25	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG11_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG11_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG11_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of GBG11_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.