UniProt ID | GBF3_ARATH | |
---|---|---|
UniProt AC | P42776 | |
Protein Name | G-box-binding factor 3 | |
Gene Name | GBF3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 382 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.. | |
Protein Sequence | MGNSSEEPKPPTKSDKPSSPPVDQTNVHVYPDWAAMQAYYGPRVAMPPYYNSAMAASGHPPPPYMWNPQHMMSPYGAPYAAVYPHGGGVYAHPGIPMGSLPQGQKDPPLTTPGTLLSIDTPTKSTGNTDNGLMKKLKEFDGLAMSLGNGNPENGADEHKRSRNSSETDGSTDGSDGNTTGADEPKLKRSREGTPTKDGKQLVQASSFHSVSPSSGDTGVKLIQGSGAILSPGVSANSNPFMSQSLAMVPPETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANATLLDKLKCSEPEKRVPANMLSRVKNSGAGDKNKNQGDNDSNSTSKLHQLLDTKPRAKAVAAG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
124 | Phosphorylation | SIDTPTKSTGNTDNG EEECCCCCCCCCCCH | 43.98 | 28011693 | |
125 | Phosphorylation | IDTPTKSTGNTDNGL EECCCCCCCCCCCHH | 35.69 | 28011693 | |
128 | Phosphorylation | PTKSTGNTDNGLMKK CCCCCCCCCCHHHHH | 31.99 | 28011693 | |
211 | Phosphorylation | ASSFHSVSPSSGDTG HHCCEECCCCCCCCC | 23.29 | 26658240 | |
213 | Phosphorylation | SFHSVSPSSGDTGVK CCEECCCCCCCCCCE | 39.17 | 25561503 | |
214 | Phosphorylation | FHSVSPSSGDTGVKL CEECCCCCCCCCCEE | 44.03 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GBF3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GBF3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GBF3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GLK1_ARATH | GPRI1 | physical | 11828027 | |
GBF4_ARATH | GBF4 | physical | 8146148 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...