dbPTM

GBF3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GBF3_ARATH
UniProt AC	P42776
Protein Name	G-box-binding factor 3
Gene Name	GBF3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	382
Subcellular Localization	Nucleus .
Protein Description	Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control..
Protein Sequence	MGNSSEEPKPPTKSDKPSSPPVDQTNVHVYPDWAAMQAYYGPRVAMPPYYNSAMAASGHPPPPYMWNPQHMMSPYGAPYAAVYPHGGGVYAHPGIPMGSLPQGQKDPPLTTPGTLLSIDTPTKSTGNTDNGLMKKLKEFDGLAMSLGNGNPENGADEHKRSRNSSETDGSTDGSDGNTTGADEPKLKRSREGTPTKDGKQLVQASSFHSVSPSSGDTGVKLIQGSGAILSPGVSANSNPFMSQSLAMVPPETWLQNERELKRERRKQSNRESARRSRLRKQAETEELARKVEALTAENMALRSELNQLNEKSDKLRGANATLLDKLKCSEPEKRVPANMLSRVKNSGAGDKNKNQGDNDSNSTSKLHQLLDTKPRAKAVAAG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	SIDTPTKSTGNTDNG EEECCCCCCCCCCCH	43.98	28011693
125	Phosphorylation	IDTPTKSTGNTDNGL EECCCCCCCCCCCHH	35.69	28011693
128	Phosphorylation	PTKSTGNTDNGLMKK CCCCCCCCCCHHHHH	31.99	28011693
211	Phosphorylation	ASSFHSVSPSSGDTG HHCCEECCCCCCCCC	23.29	26658240
213	Phosphorylation	SFHSVSPSSGDTGVK CCEECCCCCCCCCCE	39.17	25561503
214	Phosphorylation	FHSVSPSSGDTGVKL CEECCCCCCCCCCEE	44.03	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GBF3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GBF3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GBF3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
GLK1_ARATH	GPRI1	physical	11828027
GBF4_ARATH	GBF4	physical	8146148

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GBF3_ARATH

Related Literatures of Post-Translational Modification