GATL4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GATL4_ARATH
• UniProt AC: Q9M8J2
• Protein Name: Probable galacturonosyltransferase-like 4
• Gene Name: GATL4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 351
• Subcellular Localization: Golgi apparatus membrane; Single-pass type II membrane protein.
• Protein Description: May be involved in pectin and/or xylans biosynthesis in cell walls..
• Protein Sequence: MASRSLSYTQLLGLLSFILLLVTTTTMAVRVGVILHKPSAPTLPVFREAPAFRNGDQCGTREADQIHIAMTLDTNYLRGTMAAVLSLLQHSTCPENLSFHFLSLPHFENDLFTSIKSTFPYLNFKIYQFDPNLVRSKISKSIRQALDQPLNYARIYLADIIPSSVDRIIYLDSDLVVVDDIEKLWHVEMEGKVVAAPEYCHANFTHYFTRTFWSDPVLVKVLEGKRPCYFNTGVMVVDVNKWRKGMYTQKVEEWMTIQKQKRIYHLGSLPPFLLIFAGDIKAVNHRWNQHGLGGDNFEGRCRTLHPGPISLLHWSGKGKPWLRLDSRKPCIVDHLWAPYDLYRSSRHSLEE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
96	N-linked_Glycosylation	QHSTCPENLSFHFLS HHCCCCCCCEEEEEC	26.57	-
203	N-linked_Glycosylation	APEYCHANFTHYFTR CCCHHHCCCEEEEEE	20.77	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GATL4_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GATL4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GATL4_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GATL4_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.