UniProt ID | GATA2_RAT | |
---|---|---|
UniProt AC | Q924Y4 | |
Protein Name | Endothelial transcription factor GATA-2 | |
Gene Name | Gata2 {ECO:0000312|EMBL:AAK51128.1} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 480 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3' (By similarity). Plays an important role in the regulation of phagocytosis in alveolar macrophages, particularly during P.carinii infection.. | |
Protein Sequence | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMKMEGGSPLRPGLAPMGTQPATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSSKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
73 | Phosphorylation | ARARVSYSPAHARLT HHCCEECCCCHHHCC | 14.22 | - | |
86 | Asymmetric dimethylarginine | LTGGQMCRPHLLHSP CCCCCCCCCHHCCCC | 19.14 | - | |
86 | Methylation | LTGGQMCRPHLLHSP CCCCCCCCCHHCCCC | 19.14 | - | |
192 | Phosphorylation | PSTTGAASPASPSAG CCCCCCCCCCCCCCC | 22.06 | - | |
195 | Phosphorylation | TGAASPASPSAGGSV CCCCCCCCCCCCCCC | 23.83 | 22108457 | |
197 | Phosphorylation | AASPASPSAGGSVAR CCCCCCCCCCCCCCC | 36.73 | 22108457 | |
409 | Acetylation | SKSKKSKKGAECFEE CCCHHHHHHHHHHHH | 71.14 | 26302492 | |
419 | Acetylation | ECFEELSKCMQEKSS HHHHHHHHHHHHCCC | 46.48 | 26302492 | |
424 | Acetylation | LSKCMQEKSSPFSAA HHHHHHHCCCHHHHH | 39.06 | 26302492 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATA2_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATA2_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATA2_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GATA2_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...