| UniProt ID | GATA2_RAT | |
|---|---|---|
| UniProt AC | Q924Y4 | |
| Protein Name | Endothelial transcription factor GATA-2 | |
| Gene Name | Gata2 {ECO:0000312|EMBL:AAK51128.1} | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 480 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3' (By similarity). Plays an important role in the regulation of phagocytosis in alveolar macrophages, particularly during P.carinii infection.. | |
| Protein Sequence | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMKMEGGSPLRPGLAPMGTQPATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSSKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 73 | Phosphorylation | ARARVSYSPAHARLT HHCCEECCCCHHHCC | 14.22 | - | |
| 86 | Asymmetric dimethylarginine | LTGGQMCRPHLLHSP CCCCCCCCCHHCCCC | 19.14 | - | |
| 86 | Methylation | LTGGQMCRPHLLHSP CCCCCCCCCHHCCCC | 19.14 | - | |
| 192 | Phosphorylation | PSTTGAASPASPSAG CCCCCCCCCCCCCCC | 22.06 | - | |
| 195 | Phosphorylation | TGAASPASPSAGGSV CCCCCCCCCCCCCCC | 23.83 | 22108457 | |
| 197 | Phosphorylation | AASPASPSAGGSVAR CCCCCCCCCCCCCCC | 36.73 | 22108457 | |
| 409 | Acetylation | SKSKKSKKGAECFEE CCCHHHHHHHHHHHH | 71.14 | 26302492 | |
| 419 | Acetylation | ECFEELSKCMQEKSS HHHHHHHHHHHHCCC | 46.48 | 26302492 | |
| 424 | Acetylation | LSKCMQEKSSPFSAA HHHHHHHCCCHHHHH | 39.06 | 26302492 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATA2_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATA2_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATA2_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GATA2_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...