dbPTM

GATA2_CHICK - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GATA2_CHICK
UniProt AC	P23824
Protein Name	GATA-binding factor 2
Gene Name	GATA2
Organism	Gallus gallus (Chicken).
Sequence Length	466
Subcellular Localization	Nucleus.
Protein Description	Transcriptional activator which probably serves as a general switch factor for cell-specific development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of genes..
Protein Sequence	MEVATDQPRWMTHHAVLNGQHPESHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANSAHARARVSYSQAHARLTGSQMCRPHLIHSPGIPWLDSSKAALSAHHHNPWTVNPFTKTPLHPSAAGAPGAISVYPGSSTSSTASVSSLTPASHSGSHLFGFPPTPPKEVSPDPNSTSAASPSSSAGARQEDKDSIKYQVSLSEGMKMESASPLRSSLTSMGAQPSTHHPIPTYPSYVPAAHDYSSSLFHPGSFLGGPASSFTPKPRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGSECFEELSKCMQEKSSPFSAAALASHMAPMGHLPPFSHSGHILPTPTPIHPSSSISFGHPHPSSMVTAMG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GATA2_CHICK !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GATA2_CHICK !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GATA2_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GATA2_CHICK !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of GATA2_CHICK !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GATA2_CHICK

Related Literatures of Post-Translational Modification