| UniProt ID | GATA1_CHICK | |
|---|---|---|
| UniProt AC | P17678 | |
| Protein Name | Erythroid transcription factor | |
| Gene Name | GATA1 | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 304 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcriptional activator or repressor which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence 5'-[AT]GATA[AG]-3' within regulatory regions of globin genes and of other genes expressed in erythroid cells.. | |
| Protein Sequence | MEFVALGGPDAGSPTPFPDEAGAFLGLGGGERTEAGGLLASYPPSGRVSLVPWADTGTLGTPQWVPPATQMEPPHYLELLQPPRGSPPHPSSGPLLPLSSGPPPCEARECVNCGATATPLWRRDGTGHYLCNACGLYHRLNGQNRPLIRPKKRLLVSKRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPLTMRKDGIQTRNRKVSSKGKKRRPPGGGNPSATAGGGAPMGGGGDPSMPPPPPPPAAAPPQSDALYALGPVVLSGHFLPFGNSGGFFGGGAGGYTAPPGLSPQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 151 | Acetylation | NRPLIRPKKRLLVSK CCCCCCCCCEEEEEC | 40.45 | 9859997 | |
| 152 | Acetylation | RPLIRPKKRLLVSKR CCCCCCCCEEEEECC | 51.46 | 9859997 | |
| 158 | Acetylation | KKRLLVSKRAGTVCS CCEEEEECCCCCEEC | 38.50 | 9859997 | |
| 193 | Acetylation | NACGLYYKLHQVNRP HHHHHHHHHHHCCCC | 26.41 | 9859997 | |
| 205 | Acetylation | NRPLTMRKDGIQTRN CCCCEECCCCCCCCC | 49.86 | 9859997 | |
| 214 | Acetylation | GIQTRNRKVSSKGKK CCCCCCCCCCCCCCC | 50.44 | 9859997 | |
| 218 | Acetylation | RNRKVSSKGKKRRPP CCCCCCCCCCCCCCC | 68.21 | 9859997 | |
| 220 | Acetylation | RKVSSKGKKRRPPGG CCCCCCCCCCCCCCC | 47.01 | 9859997 | |
| 221 | Acetylation | KVSSKGKKRRPPGGG CCCCCCCCCCCCCCC | 63.41 | 9859997 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GATA1_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GATA1_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GATA1_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Regulation of activity of the transcription factor GATA-1 byacetylation."; Boyes J., Byfield P., Nakatani Y., Ogryzko V.; Nature 396:594-598(1998). Cited for: INTERACTION WITH EP300, ACETYLATION AT LYS-158; LYS-214; LYS-218 ANDLYS-220, AND MUTAGENESIS OF 151-LYS-LYS-152 AND LYS-158. | |