GAR1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GAR1_DROME
• UniProt AC: Q7KVQ0
• Protein Name: Probable H/ACA ribonucleoprotein complex subunit 1
• Gene Name: CG4038
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 237
• Subcellular Localization: Nucleus, nucleolus.
• Protein Description: Required for ribosome biogenesis. Part of a complex which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs (By similarity)..
• Protein Sequence: MGFGKPRGGGGGGGRGFGGGGGGGGRGFGGGGGGRGGGGGRGGGGGFGRGGGGRGGGRGAFDTGPPERVIPLGNYVYSCQNDLVCKVDIQDVPYFNAPIFLENKEQVGKIDEIFGTVRDYSVSIKLSDNVYANSFKPNQKLFIDPGKLLPIARFLPKPPQPKGAKKAFTNNRGGGGGGGGFGGRGGGRGGGGRGGGGGRGGGGFRGGAGRNGGGGGGGGFNRGRGGGGGGGGGRGRW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of GAR1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GAR1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GAR1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GAR1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.