UniProt ID | GAMT_HUMAN | |
---|---|---|
UniProt AC | Q14353 | |
Protein Name | Guanidinoacetate N-methyltransferase | |
Gene Name | GAMT | |
Organism | Homo sapiens (Human). | |
Sequence Length | 236 | |
Subcellular Localization | ||
Protein Description | Converts guanidinoacetate to creatine, using S-adenosylmethionine as the methyl donor. [PubMed: 26003046] | |
Protein Sequence | MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSAPSATPI ------CCCCCCCCC | 49.22 | 22223895 | |
2 | Phosphorylation | ------MSAPSATPI ------CCCCCCCCC | 49.22 | 27251275 | |
5 | Phosphorylation | ---MSAPSATPIFAP ---CCCCCCCCCCCC | 44.48 | 27251275 | |
7 | Phosphorylation | -MSAPSATPIFAPGE -CCCCCCCCCCCCCC | 22.66 | 27251275 | |
17 | Phosphorylation | FAPGENCSPAWGAAP CCCCCCCCCCCCCCC | 29.27 | 27251275 | |
27 | Phosphorylation | WGAAPAAYDAADTHL CCCCCHHHHHHHHHH | 14.28 | 26552605 | |
32 | Phosphorylation | AAYDAADTHLRILGK HHHHHHHHHHHHCCC | 20.34 | 27251275 | |
39 | Ubiquitination | THLRILGKPVMERWE HHHHHCCCCHHHHCC | 30.87 | - | |
60 | Ubiquitination | LAAAASSKGGRVLEV HHHHHHCCCCEEEEE | 63.99 | - | |
109 | Ubiquitination | WAPRQTHKVIPLKGL CCCCCCCEEEECCCH | 45.29 | - | |
222 | Phosphorylation | VPPADCRYYAFPQMI CCCCHHCCEECCCCC | 12.89 | 17053785 | |
223 | Phosphorylation | PPADCRYYAFPQMIT CCCHHCCEECCCCCC | 5.17 | 17053785 | |
235 | Ubiquitination | MITPLVTKG------ CCCCCCCCC------ | 55.96 | 2190698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GAMT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAMT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAMT_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYFM_HUMAN | FARS2 | physical | 26186194 | |
SYFM_HUMAN | FARS2 | physical | 28514442 |
loading...
Phosphorylation | |
Reference | PubMed |
"Tyrosine phosphorylated Par3 regulates epithelial tight junctionassembly promoted by EGFR signaling."; Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A.,Lottspeich F., Chen Z.; EMBO J. 25:5058-5070(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-222 AND TYR-223, ANDMASS SPECTROMETRY. |