UniProt ID | GALK1_MOUSE | |
---|---|---|
UniProt AC | Q9R0N0 | |
Protein Name | Galactokinase | |
Gene Name | Galk1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 392 | |
Subcellular Localization | ||
Protein Description | Major enzyme for galactose metabolism.. | |
Protein Sequence | MAAWRPPRVEELLAEARRAFMEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVMVGSPRTDGLVSLLTTSKDADEPQRLQFPLPSAQWSLEPGIPQWANYVKGVIQHYPASPLVGFSAVVVSSVPLGGGLSSSASLEVATYTFIQQLCPDSGAIAARAQVCQRAEHSFAGVPCGIMDQLIALLGQKGYALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLGSSEYPVRRRQCEEVAQALGKESLREVRMEELEAGRELMSKEGFRRARHVVSEIRRTAQAAAAMSRGDYKAFGRLMVESHYSLRDDYEVSCPELDQLVEAALSVPGVYGSRMTGGGFGGCTVTLLEASVAPLVIDHIQEQYSGTATFYLSQAADGAQVLSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
80 | Acetylation | VSLLTTSKDADEPQR HHHEECCCCCCCCCC | 60.05 | 23954790 | |
80 | Ubiquitination | VSLLTTSKDADEPQR HHHEECCCCCCCCCC | 60.05 | - | |
80 | Succinylation | VSLLTTSKDADEPQR HHHEECCCCCCCCCC | 60.05 | 23954790 | |
217 | Acetylation | LVPLSDPKLAVLITN EEECCCCCEEEEEEC | 4.92 | 23954790 | |
217 | Ubiquitination | LVPLSDPKLAVLITN EEECCCCCEEEEEEC | 4.92 | - | |
217 | Ubiquitination | LVPLSDPKLAVLITN EEECCCCCEEEEEEC | 4.92 | - | |
223 | O-linked_Glycosylation | PKLAVLITNSNVRHS CCEEEEEECCCHHHC | 25.29 | 30059200 | |
230 | Phosphorylation | TNSNVRHSLGSSEYP ECCCHHHCCCCCCCC | 6.70 | 22817900 | |
233 | Phosphorylation | NVRHSLGSSEYPVRR CHHHCCCCCCCCCCH | 39.07 | 28066266 | |
234 | Phosphorylation | VRHSLGSSEYPVRRR HHHCCCCCCCCCCHH | 56.40 | 28066266 | |
272 | Acetylation | AGRELMSKEGFRRAR HHHHHHHHHHHHHHH | 57.15 | 22826441 | |
272 | Acetylation | AGRELMSKEGFRRAR HHHHHHHHHHHHHHH | 57.15 | - | |
272 | Malonylation | AGRELMSKEGFRRAR HHHHHHHHHHHHHHH | 57.15 | 26320211 | |
301 | Malonylation | AMSRGDYKAFGRLMV HHHCCCHHHHHHHHH | 13.09 | 26320211 | |
301 | Succinylation | AMSRGDYKAFGRLMV HHHCCCHHHHHHHHH | 13.09 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GALK1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GALK1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GALK1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of GALK1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...