GAG_SIVG1 - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GAG_SIVG1
• UniProt AC: Q02843
• Protein Name: Gag polyprotein
• Gene Name: gag
• Organism: Simian immunodeficiency virus agm.grivet (isolate AGM gr-1) (SIV-agm.gri) (Simian immunodeficiency virus African green monkey grivet).
• Sequence Length: 513
• Subcellular Localization: Matrix protein p17: Virion . Host nucleus. Host cytoplasm. Host cell membrane ; Lipid-anchor . Following virus entry, the nuclear localization signal (NLS) of the matrix protein participates with Vpr to the nuclear localization of the viral genome. D
• Protein Description: Matrix protein p17 targets Gag and Gag-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the preintegration complex. Implicated in the release from host cell mediated by Vpu (By similarity).; Capsid protein p24 forms the conical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.; Nucleocapsid protein p7 encapsulates and protects viral dimeric unspliced (genomic) RNA. Binds these RNAs through its zinc fingers (By similarity).; p6-gag plays a role in budding of the assembled particle by interacting with the host class E VPS proteins TSG101 and PDCD6IP/AIP1..
• Protein Sequence: MGGGHSALSGRSLDTFEKIRLRPNGKKKYQIKHLIWAGKEMERFGLHEKLLETKEGCQKIIEVLTPLEPTGSEGLKALFNLCCVIWCIHAEQKVKDTEEAVVTVKQHYHLVDKNEKAAKKKNETTAPPGGESRNYPVVNQNNAWVHQPLSPRTLNAWVKCVEEKRWGAEVVPMFQALSEGCLSYDVNQMLNVIGDHQGALQILKEVINEEAAEWDRTHRPPAGPLPAGQLRDPTGSDIAGTTSSIQEQIEWTFNANPRIDVGAQYRKWVILGLQKVVQMYNPQKVLDIRQGPKEPFQDYVDRFYKALRAEQAPQDVKNWMTQTLLIQNANPDCKLILKGLGMNPTLEEMLIACQGVGGPQHKAKLMVEMMSNGQNMVQVGPQKKGPRGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIGHMAKDCKNGQANFLGYGHWGGAKPRNFVQYRGDTVGLEPTAPPMETAYDPAKKLLQQYAEKGQRLREEREQTRKQKEKEVEDVSLSSLFGGDQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGGGHSALS ------CCCCCCCCC	51.28	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GAG_SIVG1 !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GAG_SIVG1 !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GAG_SIVG1 !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WWP1_HUMAN	WWP1	physical	15163754

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.