GAE5_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GAE5_ARATH
• UniProt AC: Q9STI6
• Protein Name: UDP-glucuronate 4-epimerase 5
• Gene Name: GAE5
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 436
• Subcellular Localization: Golgi apparatus, Golgi stack membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components..
• Protein Sequence: MSHLDDLPSTPGKYKTDKVPPYGILHHHRYLRLSKLTLWASLFLALFLFYLVLSPPPSPSRRNLNDSSSISAAKYGGSHWEKQVRKSARPRSHGGLTVLVTGASGFVGTHVSIALRRRGDGVLGLDNFNRYYDPKLKRARQGLLERSGVFVVEGDINDAVLLRKLFDVVLFTHVMHLAAQAGVRYAMQNPGSYVNSNIAGFVNLLEVSKSANPQPAIVWASSSSVYGLNSKVPFSEKDRTDQPASLYAATKKAGEGIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTKDILKGKTITVFESPDKGSVARDFTYIDDIVKGCLGALDTAEKSTGSGGKKKGPAMFRIYNLGNTSPVPVTKLVTILEKLLKMKAKKKIMPLPRNGDVEFTHANITLAQAELGYKPAVDLETGLKKFVKWYMGFYTGSKKKSSW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
317	Phosphorylation	GSVARDFTYIDDIVK CCCCCCCEEHHHHHH	24.69	28295753
318	Phosphorylation	SVARDFTYIDDIVKG CCCCCCEEHHHHHHH	11.44	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GAE5_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GAE5_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GAE5_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of GAE5_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.