UniProt ID | FXL17_MOUSE | |
---|---|---|
UniProt AC | Q9QZN1 | |
Protein Name | F-box/LRR-repeat protein 17 | |
Gene Name | Fbxl17 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 701 | |
Subcellular Localization | ||
Protein Description | Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.. | |
Protein Sequence | MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRALAKASPQPAAPRSRDCFFRGPCMLCFIVHSPGAPASAGLEEEPPLSPPPPPPRDGAYAAVSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAASSPASCCKELGLAAAAAWEQQGRSLFLAGVGPVRFLGPLAAVQLFRAPPAPPPQAEPATALEMVCKRKGAGVPACTPCKQPRCGCGGCGGGGGGGGGPAGGGASPPRPPDAGCCQAPEQPPPPLCPAPASPASECAPIVAAAGDTVRAGGTAPSSAQQQPESGDADCQEPPENPCDCHREPPPEIPDINQLPPSILLKIFSNLSLNERCLSASLVCKYWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSLSDSGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSRCRELKDIHFGQCYKISDEGMIVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSVTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNELTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAATS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | Ubiquitination | LPRRALAKASPQPAA CCHHHHHHCCCCCCC | 50.69 | 27667366 | |
42 | Phosphorylation | RRALAKASPQPAAPR HHHHHHCCCCCCCCC | 24.30 | 29899451 | |
83 | Phosphorylation | LEEEPPLSPPPPPPR CCCCCCCCCCCCCCC | 40.93 | 21183079 | |
106 | Phosphorylation | SQHLARRYAALAAED HHHHHHHHHHHHHHH | 7.23 | 29514104 | |
209 | Phosphorylation | GAGVPACTPCKQPRC CCCCCCCCCCCCCCC | 33.55 | - | |
607 | Phosphorylation | VSCKITDYALIAIGR EECCCCCEEEEEEEE | 8.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FXL17_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FXL17_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FXL17_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FXL17_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...