FXL12_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FXL12_MOUSE
• UniProt AC: Q9EPX5
• Protein Name: F-box/LRR-repeat protein 12
• Gene Name: Fbxl12
• Organism: Mus musculus (Mouse).
• Sequence Length: 326
• Protein Description: Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Mediates the polyubiquitination and proteasomal degradation of CAMK1 leading to disruption of cyclin D1/CDK4 complex assembly which results in G1 cell cycle arrest in lung epithelia (By similarity)..
• Protein Sequence: MATLFDLPDLVLLEIFSYLPVRDRIRISRVCHRWKRLVDDRWLWRHVDLTLYTMRPKVMWHLLRRYMASRLYSLRMGGYLFSGSQAPQLSPALMRALGQKCPNLKRLCLHVADLSMVPITSLPSTLRTLELHSCEISMIWLQKEQDPTVLPLLECIVLDRVPAFRDEHLQGLTRFRALRSLVLGGTYRVTETGLDASLQELSYLQRLEVLGCTLSADSTLLAISRHLRDVRKIRLTVGGLSAQGLVFLEGMPVLESLCFQGPLITPDMPTPTQIVSSCLTMPKLRVLEVQGLGWEGQEAEKILCKGLPHCIVIVRACPKESMDWWM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
192	Phosphorylation	GTYRVTETGLDASLQ CEEEECCCCCCHHHH	33.41	26370283
197	Phosphorylation	TETGLDASLQELSYL CCCCCCHHHHHHHHH	30.19	26370283
203	Phosphorylation	ASLQELSYLQRLEVL HHHHHHHHHHHHHHH	21.34	26370283

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FXL12_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FXL12_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FXL12_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KCC1A_MOUSE	Camk1	physical	23707388

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.