UniProt ID | FUT2_HUMAN | |
---|---|---|
UniProt AC | Q10981 | |
Protein Name | Galactoside 2-alpha-L-fucosyltransferase 2 | |
Gene Name | FUT2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 343 | |
Subcellular Localization |
Golgi apparatus, Golgi stack membrane Single-pass type II membrane protein. Membrane-bound form in trans cisternae of Golgi. |
|
Protein Description | Mediates the transfer of fucose to the terminal galactose on glycan chains of cell surface glycoproteins and glycolipids. [PubMed: 7876235 The resulting epitope plays a role in cell-cell interaction including host-microbe interaction] | |
Protein Sequence | MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
188 | N-linked_Glycosylation | FLRGLQVNGSRPGTF HHHCCCCCCCCCCEE | 29.75 | UniProtKB CARBOHYD | |
205 | Phosphorylation | VHVRRGDYVHVMPKV EEEECCCEEEECCCE | 8.69 | - | |
282 | N-linked_Glycosylation | FALLTQCNHTIMTIG HHHHHCCCCEEEECC | 26.06 | UniProtKB CARBOHYD | |
308 | N-linked_Glycosylation | GDTIYLANYTLPDSP CCEEEEEECCCCCCC | 27.94 | UniProtKB CARBOHYD | |
314 | Phosphorylation | ANYTLPDSPFLKIFK EECCCCCCCCHHHCC | 18.66 | 24719451 | |
338 | Phosphorylation | TGIAADLSPLLKH-- CCCCCCCHHHHCC-- | 17.66 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUT2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUT2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUT2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FUT2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...