dbPTM

FUS3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FUS3_ARATH
UniProt AC	Q9LW31
Protein Name	B3 domain-containing transcription factor FUS3
Gene Name	FUS3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	313
Subcellular Localization	Nucleus .
Protein Description	Transcription regulator involved in gene regulation during late embryogenesis. Its expression to the epidermis is sufficient to control foliar organ identity by regulating positively the synthesis abscisic acid (ABA) and negatively gibberellin production. Negatively regulates TTG1 in the embryo. Positively regulates the abundance of the ABI3 protein in the seed..
Protein Sequence	MMVDENVETKASTLVASVDHGFGSGSGHDHHGLSASVPLLGVNWKKRRMPRQRRSSSSFNLLSFPPPMPPISHVPTPLPARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASEEEEVDVINLEEDDVYTNLTRIENTVVNDLLLQDFNHHNNNNNNNSNSNSNKCSYYYPVIDDVTTNTESFVYDTTALTSNDTPLDFLGGHTTTTNNYYSKFGTFDGLGSVENISLDDFY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FUS3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FUS3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Reference
55	S	Phosphorylation	28922765
Phosphorylated at one or more of the Ser-55, Ser-56 and/or Ser-57 residues.
56	S	Phosphorylation	28922765
Phosphorylated at one or more of the Ser-55, Ser-56 and/or Ser-57 residues.
57	S	Phosphorylation	28922765
Phosphorylated at one or more of the Ser-55, Ser-56 and/or Ser-57 residues.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FUS3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
KIN10_ARATH	KIN10	physical	22026387

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FUS3_ARATH

Related Literatures of Post-Translational Modification