FUCO1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FUCO1_ARATH
• UniProt AC: Q8GW72
• Protein Name: Alpha-L-fucosidase 1
• Gene Name: FUC1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 506
• Subcellular Localization: Secreted, extracellular space, apoplast .
• Protein Description: Hydrolyzes both 3- and 4-linked fucoses in Lewis determinants. Not active on neither 2-linked fucose nor on fucose in alpha-1,3-linkage to the innermost GlcNAc..
• Protein Sequence: MNSQITLFFFFFSILSLSQISNSSSLLKPHPCPILPLPSSQQLQWQLGSMAMFLHFGPNTFTDSEWGTGKANPSIFNPTHLNASQWVQIAKDSGFSRVILTAKHHDGFCLWPSEYTDYSVKSSQWRNGAGDVVAELASAAKEAGIGLGLYLSPWDRHEQCYGKTLEYNEFYLSQMTELLTKYGEIKEVWLDGAKGDGEKDMEYFFDTWFSLIHQLQPKAVIFSDAGPDVRWIGDEAGLAGSTCWSLFNRTNAKIGDTEPSYSQEGDGYGQDWVPAECDVSIRPGWFWHASESPKPAVQLLDIYYNSVGRNCLFLLNVPPNSSGLISEQDIKVLEEFSEMKNSIFSNNLARKAFVNSSSIRGDQSSQFGPKNVLEEGLDKYWAPEENQNEWVLYLEFKDLVSFNVLEIREPIHMGQRIASFHLETRKTGSGEWERVVSGTTVGNKRLLRFLNVVESRSLKLVVDKARTDPLISYLGLYMDKFSGSSRNTTKITITRTLKEEQQLHDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22	N-linked_Glycosylation	LSLSQISNSSSLLKP HHHHHCCCCCCCCCC	47.76	-
82	N-linked_Glycosylation	IFNPTHLNASQWVQI HCCCCCCCHHHHHHH	29.91	-
182	Phosphorylation	MTELLTKYGEIKEVW HHHHHHHHCCEEEEE	18.11	19880383
248	N-linked_Glycosylation	STCWSLFNRTNAKIG HHHHHHHHCCCCCCC	55.98	-
320	N-linked_Glycosylation	FLLNVPPNSSGLISE EEEECCCCCCCCCCH	42.62	-
321	Phosphorylation	LLNVPPNSSGLISEQ EEECCCCCCCCCCHH	31.40	19880383
322	Phosphorylation	LNVPPNSSGLISEQD EECCCCCCCCCCHHH	44.23	19880383
326	Phosphorylation	PNSSGLISEQDIKVL CCCCCCCCHHHHHHH	33.96	19880383
355	N-linked_Glycosylation	LARKAFVNSSSIRGD HHHHHHCCCHHHCCC	29.71	-
487	N-linked_Glycosylation	KFSGSSRNTTKITIT CCCCCCCCCCEEEEE	54.79	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FUCO1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FUCO1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FUCO1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of FUCO1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.