UniProt ID | FRDA_HUMAN | |
---|---|---|
UniProt AC | Q16595 | |
Protein Name | Frataxin, mitochondrial | |
Gene Name | FXN | |
Organism | Homo sapiens (Human). | |
Sequence Length | 210 | |
Subcellular Localization | Mitochondrion . Cytoplasm, cytosol . PubMed:18725397 reports localization exclusively in mitochondria. | |
Protein Description | Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization; however, the physiological relevance is unsure as reports are conflicting and the function has only been shown using heterologous overexpression systems. Modulates the RNA-binding activity of ACO1.. | |
Protein Sequence | MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | CGRRGLRTDIDATCT CCCCCCCCCCCCCCC | 42.20 | 28258704 | |
49 | Phosphorylation | LRTDIDATCTPRRAS CCCCCCCCCCCCCCC | 17.11 | 30177828 | |
51 | Phosphorylation | TDIDATCTPRRASSN CCCCCCCCCCCCCCC | 18.57 | 28258704 | |
56 | Phosphorylation | TCTPRRASSNQRGLN CCCCCCCCCCCCCHH | 28.19 | 30177828 | |
57 | Phosphorylation | CTPRRASSNQRGLNQ CCCCCCCCCCCCHHH | 35.68 | 30177828 | |
81 | Phosphorylation | YLMNLRKSGTLGHPG EEEECCCCCCCCCCC | 30.49 | 25159151 | |
83 | Phosphorylation | MNLRKSGTLGHPGSL EECCCCCCCCCCCCC | 36.34 | 25627689 | |
94 | Phosphorylation | PGSLDETTYERLAEE CCCCCHHHHHHHHHH | 22.72 | - | |
118 | Phosphorylation | EDLADKPYTFEDYDV HHHCCCCCCCCCCEE | 29.78 | - | |
143 | Nitration | LGGDLGTYVINKQTP ECCCCEEEEEECCCC | 9.49 | - | |
143 | Phosphorylation | LGGDLGTYVINKQTP ECCCCEEEEEECCCC | 9.49 | - | |
157 | Phosphorylation | PNKQIWLSSPSSGPK CCCEEEEECCCCCCC | 25.80 | 25278378 | |
158 | Phosphorylation | NKQIWLSSPSSGPKR CCEEEEECCCCCCCC | 26.99 | 25278378 | |
160 | Phosphorylation | QIWLSSPSSGPKRYD EEEEECCCCCCCCCC | 50.29 | 25278378 | |
161 | Phosphorylation | IWLSSPSSGPKRYDW EEEECCCCCCCCCCC | 63.60 | 25278378 | |
175 | Nitration | WTGKNWVYSHDGVSL CCCCCCEECCCCCCH | 7.60 | - | |
175 (in isoform 3) | Phosphorylation | - | 7.60 | - | |
178 (in isoform 3) | Phosphorylation | - | 53.93 | - | |
187 (in isoform 3) | Phosphorylation | - | 16.12 | - | |
197 (in isoform 1) | Ubiquitination | - | 38.12 | 21890473 | |
197 | Acetylation | LTKALKTKLDLSSLA HHHHHHHHHCHHHHH | 38.12 | 23954790 | |
197 | Ubiquitination | LTKALKTKLDLSSLA HHHHHHHHHCHHHHH | 38.12 | 21890473 | |
205 | Nitration | LDLSSLAYSGKDA-- HCHHHHHHCCCCC-- | 24.21 | - | |
205 | Phosphorylation | LDLSSLAYSGKDA-- HCHHHHHHCCCCC-- | 24.21 | - | |
208 | Acetylation | SSLAYSGKDA----- HHHHHCCCCC----- | 44.54 | 25038526 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
118 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FRDA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FRDA_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACTN1_HUMAN | ACTN1 | physical | 16713569 | |
PICK1_HUMAN | PICK1 | physical | 16713569 | |
RN126_HUMAN | RNF126 | physical | 28228265 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
229300 | Friedreich ataxia (FRDA) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...