UniProt ID | FOXG1_MOUSE | |
---|---|---|
UniProt AC | Q60987 | |
Protein Name | Forkhead box protein G1 | |
Gene Name | Foxg1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 481 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcription repression factor which plays an important role in the establishment of the regional subdivision of the developing brain and in the development of the telencephalon.. | |
Protein Sequence | MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHHHHHHHHPPPPAPQPPPPPPQQQQQQPPPAPQPPQARGAPAADDDKGPQPLLLPPSTALDGAKADALGAKGEPGGGPAELAPVGPDEKEKGAGAGGEEKKGAGEGGKDGEGGKEGDKKNGKYEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDRAGSLYWPMSPFLSLHHPRASSTLSYNGTTSAYPSHPMPYSSVLTQNSLGNNHSFSTANGLSVDRLVNGEIPYATHHLTAAALAASVPCGLSVPCSGTYSLNPCSVNLLAGQTSYFFPHVPHPSMTSQTSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
226 | Phosphorylation | NSIRHNLSLNKCFVK HHHHHCCCCCCCEEE | 34.90 | 29176673 | |
271 | Phosphorylation | KLRRRSTTSRAKLAF CCCCCCCCHHHHHHH | 19.91 | 21228151 | |
286 | Phosphorylation | KRGARLTSTGLTFMD HHCCCEECCCCEEEC | 25.68 | 29514104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
271 | T | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOXG1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOXG1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FOXG1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...