| UniProt ID | FOLR3_HUMAN | |
|---|---|---|
| UniProt AC | P41439 | |
| Protein Name | Folate receptor gamma | |
| Gene Name | FOLR3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 243 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Isoform Short does not bind folate.. | |
| Protein Sequence | MAWQMMQLLLLALVTAAGSAQPRSARARTDLLNVCMNAKHHKTQPSPEDELYGQCSPWKKNACCTASTSQELHKDTSRLYNFNWDHCGKMEPTCKRHFIQDSCLYECSPNLGPWIRQVNQSWRKERILNVPLCKEDCERWWEDCRTSYTCKSNWHKGWNWTSGINECPAGALCSTFESYFPTPAALCEGLWSHSFKVSNYSRGSGRCIQMWFDSAQGNPNEEVAKFYAAAMNAGAPSRGIIDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | LLLLALVTAAGSAQP HHHHHHHHHHHCCCC | 16.19 | 24043423 | |
| 19 | Phosphorylation | ALVTAAGSAQPRSAR HHHHHHHCCCCCCHH | 21.00 | 24043423 | |
| 24 | Phosphorylation | AGSAQPRSARARTDL HHCCCCCCHHHHHHH | 28.87 | 24043423 | |
| 119 | N-linked_Glycosylation | GPWIRQVNQSWRKER HHHHHHHHHHHHHHH | 23.10 | UniProtKB CARBOHYD | |
| 121 | N-linked_Glycosylation | WIRQVNQSWRKERIL HHHHHHHHHHHHHHH | 24.52 | - | |
| 138 (in isoform 3) | Phosphorylation | - | 64.75 | 30257219 | |
| 140 | Phosphorylation | CKEDCERWWEDCRTS CHHHHHHHHHHHHCC | 4.78 | 30257219 | |
| 140 (in isoform 3) | Phosphorylation | - | 4.78 | 30257219 | |
| 142 | Phosphorylation | EDCERWWEDCRTSYT HHHHHHHHHHHCCEE | 40.03 | 30257219 | |
| 159 | N-linked_Glycosylation | SNWHKGWNWTSGINE CCCCCCCCCCCCCCC | 40.59 | UniProtKB CARBOHYD | |
| 161 | N-linked_Glycosylation | WHKGWNWTSGINECP CCCCCCCCCCCCCCC | 17.54 | - | |
| 192 | Phosphorylation | ALCEGLWSHSFKVSN HHCCCHHHCEEEECC | 17.81 | - | |
| 194 | Phosphorylation | CEGLWSHSFKVSNYS CCCHHHCEEEECCCC | 22.65 | - | |
| 199 | N-linked_Glycosylation | SHSFKVSNYSRGSGR HCEEEECCCCCCCCC | 41.61 | UniProtKB CARBOHYD | |
| 201 | N-linked_Glycosylation | SFKVSNYSRGSGRCI EEEECCCCCCCCCEE | 34.12 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FOLR3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FOLR3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FOLR3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FOLR3_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
