UniProt ID | FN3KR_ARATH | |
---|---|---|
UniProt AC | Q9LEW8 | |
Protein Name | Protein-ribulosamine 3-kinase, chloroplastic | |
Gene Name | At3g61080 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 326 | |
Subcellular Localization | Plastid, chloroplast . | |
Protein Description | Initiates a process leading to the deglycation of proteins. Phosphorylates low-molecular-mass and protein-bound erythrulosamines and ribulosamines, but not fructosamines or psicosamines, on the third carbon of the sugar moiety. Protein-bound erythrulosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions.. | |
Protein Sequence | MAVASLSICFSARPHLLLRNFSPRPKFVAMAAMSEDPIREWILTEGKATQITKIGSVGGGCINLASHYQTDAGSFFVKTNRSIGPAMFEGEALGLEAMYETRTIRVPNPHKAGELPTGGSYIIMEFIDFGGSRGNQAELGRKLAEMHKAGKTSKGFGFEVDNTIGSTPQINTWSSDWIEFYGEKRLGYQLKLARDQYGDSAIYQKGHTLIQNMAPLFENVVIEPCLLHGDLWSGNIAYDKNNEPVILDPACYYGHNEADFGMSWCAGFGESFYNAYFKVMPKQAGYEKRRDLYLLYHYLNHYNLFGSGYRSSAMSIIDDYLRMLKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of FN3KR_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FN3KR_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FN3KR_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FN3KR_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FN3KR_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...