UniProt ID | FKBP8_MOUSE | |
---|---|---|
UniProt AC | O35465 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP8 | |
Gene Name | Fkbp8 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 402 | |
Subcellular Localization |
Mitochondrion membrane Single-pass membrane protein Cytoplasmic side . |
|
Protein Description | Constitutively inactive PPiase, which becomes active when bound to calmodulin and calcium. Seems to act as a chaperone for BCL2, targets it to the mitochondria and modulates its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex probably interferes with the binding of BCL2 to its targets. The active form of FKBP8 may therefore play a role in the regulation of apoptosis (By similarity). Required for normal embryonic development.. | |
Protein Sequence | MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPGALAREFLAATEPEPAPAPAPEEWLDILGNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMSLENGTRVQEEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSNTKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLGNPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MASWAEPSEP -----CCCCCCCCCC | 26.06 | 28066266 | |
102 | Ubiquitination | KTLVPGPKGSSRPLK EEECCCCCCCCCCCC | 76.86 | 22790023 | |
102 (in isoform 2) | Ubiquitination | - | 76.86 | 22790023 | |
147 | Ubiquitination | CDVIQALDLSVPLMD CHHHHHEECCCEECC | 39.66 | 27667366 | |
261 | Ubiquitination | EEELLQLKVKCLNNL HHHHHHHHHHHHHHH | 27.04 | 22790023 | |
261 (in isoform 2) | Ubiquitination | - | 27.04 | 22790023 | |
262 (in isoform 2) | Ubiquitination | - | 7.81 | - | |
263 | Malonylation | ELLQLKVKCLNNLAA HHHHHHHHHHHHHHH | 31.27 | 32601280 | |
274 | Ubiquitination | NLAASQLKLDHYRAA HHHHHHHCHHHHHHH | 44.20 | 22790023 | |
274 (in isoform 2) | Ubiquitination | - | 44.20 | 22790023 | |
275 (in isoform 2) | Ubiquitination | - | 7.16 | - | |
284 | Phosphorylation | HYRAALRSCSQVLEH HHHHHHHHHHHHHHH | 20.97 | 25266776 | |
285 | S-palmitoylation | YRAALRSCSQVLEHQ HHHHHHHHHHHHHHC | 2.39 | 28526873 | |
286 | Phosphorylation | RAALRSCSQVLEHQP HHHHHHHHHHHHHCC | 25.27 | 25266776 | |
297 (in isoform 2) | Ubiquitination | - | 45.34 | 22790023 | |
297 | Ubiquitination | EHQPDNIKALFRKGK HHCCCCHHHHHHHCC | 45.34 | - | |
297 | Malonylation | EHQPDNIKALFRKGK HHCCCCHHHHHHHCC | 45.34 | 26320211 | |
298 (in isoform 2) | Ubiquitination | - | 14.24 | - | |
304 (in isoform 2) | Ubiquitination | - | 36.79 | 22790023 | |
304 | Ubiquitination | KALFRKGKVLAQQGE HHHHHHCCEEEECCC | 36.79 | - | |
304 | Malonylation | KALFRKGKVLAQQGE HHHHHHCCEEEECCC | 36.79 | 32601280 | |
305 (in isoform 2) | Ubiquitination | - | 7.94 | - | |
313 | Phosphorylation | LAQQGEYSEAIPILR EEECCCHHHHHHHHH | 19.09 | 28066266 | |
324 (in isoform 2) | Ubiquitination | - | 46.18 | 22790023 | |
324 | Malonylation | PILRAALKLEPSNKT HHHHHHHCCCCCCCC | 46.18 | 32601280 | |
324 | Ubiquitination | PILRAALKLEPSNKT HHHHHHHCCCCCCCC | 46.18 | - | |
325 (in isoform 2) | Ubiquitination | - | 14.06 | - | |
330 | Ubiquitination | LKLEPSNKTIHAELS HCCCCCCCCHHHHHH | 53.87 | 22790023 | |
330 (in isoform 2) | Ubiquitination | - | 53.87 | 22790023 | |
331 (in isoform 2) | Ubiquitination | - | 23.42 | - | |
348 | Phosphorylation | KKRAAQRSTETALYR HHHHHHHHHHHHHHH | 20.65 | 25159016 | |
349 | Phosphorylation | KRAAQRSTETALYRK HHHHHHHHHHHHHHH | 39.27 | 28066266 | |
351 | Phosphorylation | AAQRSTETALYRKML HHHHHHHHHHHHHHH | 23.27 | 28066266 | |
354 | Phosphorylation | RSTETALYRKMLGNP HHHHHHHHHHHHCCH | 13.01 | 25159016 | |
356 | Ubiquitination | TETALYRKMLGNPSR HHHHHHHHHHCCHHH | 25.56 | 27667366 | |
357 | Ubiquitination | ETALYRKMLGNPSRL HHHHHHHHHCCHHHC | 4.24 | 27667366 | |
401 | Ubiquitination | LSVVIAARN------ HHHHHHCCC------ | 40.13 | 27667366 | |
402 | Ubiquitination | SVVIAARN------- HHHHHCCC------- | 52.06 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKBP8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKBP8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKBP8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FKBP8_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...