| UniProt ID | FKB1A_RAT | |
|---|---|---|
| UniProt AC | Q62658 | |
| Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP1A | |
| Gene Name | Fkbp1a | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 108 | |
| Subcellular Localization |
Cytoplasm, cytosol . Sarcoplasmic reticulum membrane Peripheral membrane protein Cytoplasmic side . |
|
| Protein Description | Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
| Protein Sequence | MGVQVETISSGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELLKLE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MGVQVETISSGDGR -CCCEEEEECCCCCC | 27.57 | 23984901 | |
| 9 | Phosphorylation | GVQVETISSGDGRTF CCEEEEECCCCCCCC | 35.37 | 27097102 | |
| 10 | Phosphorylation | VQVETISSGDGRTFP CEEEEECCCCCCCCC | 36.73 | 27097102 | |
| 15 | Phosphorylation | ISSGDGRTFPKRGQT ECCCCCCCCCCCCCE | 50.23 | 23984901 | |
| 35 | Ubiquitination | TGMLEDGKKFDSSRD EEEECCCCCCCCCCC | 63.69 | - | |
| 45 | Acetylation | DSSRDRNKPFKFTLG CCCCCCCCCEEEEEC | 53.37 | - | |
| 48 | Acetylation | RDRNKPFKFTLGKQE CCCCCCEEEEECCHH | 46.06 | 22902405 | |
| 53 | Acetylation | PFKFTLGKQEVIRGW CEEEEECCHHHHCCH | 46.53 | 22902405 | |
| 53 | Succinylation | PFKFTLGKQEVIRGW CEEEEECCHHHHCCH | 46.53 | - | |
| 53 | Ubiquitination | PFKFTLGKQEVIRGW CEEEEECCHHHHCCH | 46.53 | - | |
| 53 | Succinylation | PFKFTLGKQEVIRGW CEEEEECCHHHHCCH | 46.53 | - | |
| 68 | Phosphorylation | EEGVAQMSVGQRAKL HHHEEEECCCCCEEE | 15.83 | 27097102 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FKB1A_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FKB1A_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FKB1A_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FKB1A_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
