FKB14_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FKB14_MOUSE
• UniProt AC: P59024
• Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP14
• Gene Name: Fkbp14
• Organism: Mus musculus (Mouse).
• Sequence Length: 211
• Subcellular Localization: Endoplasmic reticulum lumen .
• Protein Description: PPIase which accelerates the folding of proteins during protein synthesis. Has a preference for substrates containing 4-hydroxylproline modifications, including type III collagen. May also target type VI and type X collagens..
• Protein Sequence: MRFFLWNAILALWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTVPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWRLSKHEVKVYLQKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYVHDEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
34	Acetylation	VKIEVLQKPFICHRK CEEEEECCCEEEEEC	37.42	22826441
176	N-linked_Glycosylation	EKHGAVVNESHHDAL HHHCCEECCCHHHHH	38.15	-
200	Phosphorylation	EDKDGFISAREFTYV CCCCCCEEEEEEEEE	21.00	26525534

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FKB14_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FKB14_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FKB14_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of FKB14_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.