dbPTM

FK201_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FK201_ARATH
UniProt AC	Q9M2S7
Protein Name	Peptidyl-prolyl cis-trans isomerase FKBP20-1
Gene Name	FKBP20-1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	190
Subcellular Localization
Protein Description	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity)..
Protein Sequence	MGDAIDLSGDGGVLKKIVRSAKPDAISPSDDLPVVDVHYEGILAEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPEYAYGRAGSPPDIPPDATLIFEVELVACRPRKGASVGSVSEERARLEDLKKQREIAAAAKEDDKKKREEAKAAAAARIQAKLDAKKGPGKGKGKGKAK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Acetylation	------MGDAIDLSG ------CCCCEECCC	32.81	22223895
127	Phosphorylation	CRPRKGASVGSVSEE ECCCCCCCCCCCCHH	35.36	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FK201_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FK201_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FK201_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of FK201_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FK201_ARATH

Related Literatures of Post-Translational Modification