UniProt ID | FK163_ARATH | |
---|---|---|
UniProt AC | O22870 | |
Protein Name | Peptidyl-prolyl cis-trans isomerase FKBP16-3, chloroplastic | |
Gene Name | FKBP16-3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 223 | |
Subcellular Localization | Plastid, chloroplast thylakoid lumen . | |
Protein Description | PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).. | |
Protein Sequence | MAASSPSLLLPLGSASRNGLTTKNPNSSRYIAARVIASETREQSCKISNLSSRREAMLLVLGVSGGLSMSSLAAYAAGLPPEDKPRLCEAECEKELENVPMVTTESGLQYKDIKVGRGPSPPVGFQVAANYVAMVPSGQIFDSSLEKGLPYLFRVGSGQVIKGLDEGILSMKAGGKRRLYIPGPLAFPKGLVSAPGRPRVAPNSPVIFDVSLEFIPGLDSEEE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FK163_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FK163_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FK163_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FK163_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...