UniProt ID | FIS1_RAT | |
---|---|---|
UniProt AC | P84817 | |
Protein Name | Mitochondrial fission 1 protein | |
Gene Name | Fis1 {ECO:0000250|UniProtKB:Q9Y3D6} | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 152 | |
Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . Peroxisome membrane Single-pass membrane protein . |
|
Protein Description | Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission (By similarity).. | |
Protein Sequence | MEAVLNELVSVEDLKNFERKFQSEQAAGSVSKSTQFEYAWCLVRSKYNDDIRRGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEAVLNEL -------CHHHHHHC | 7.23 | - | |
10 | Phosphorylation | AVLNELVSVEDLKNF HHHHHCCCHHHHHHH | 32.20 | - | |
29 | Phosphorylation | QSEQAAGSVSKSTQF HHHHCCCCCCCCHHH | 20.63 | 27097102 | |
31 | Phosphorylation | EQAAGSVSKSTQFEY HHCCCCCCCCHHHHH | 23.68 | 28432305 | |
46 | Acetylation | AWCLVRSKYNDDIRR EHHHHHHHCCCHHHH | 37.19 | 22902405 | |
89 | Acetylation | YRLKEYEKALKYVRG HHHHHHHHHHHHHHH | 59.11 | 22902405 | |
92 | Acetylation | KEYEKALKYVRGLLQ HHHHHHHHHHHHHHC | 46.70 | 22902405 | |
108 | Acetylation | EPQNNQAKELERLID CCCCHHHHHHHHHHH | 53.74 | 22902405 | |
108 | Ubiquitination | EPQNNQAKELERLID CCCCHHHHHHHHHHH | 53.74 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIS1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIS1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIS1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FIS1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...