UniProt ID | FGF5_HUMAN | |
---|---|---|
UniProt AC | P12034 | |
Protein Name | Fibroblast growth factor 5 | |
Gene Name | FGF5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 268 | |
Subcellular Localization | Secreted . | |
Protein Description | Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase (By similarity).. | |
Protein Sequence | MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
92 | Phosphorylation | GRRTGSLYCRVGIGF CCCCCCEEEEEEEEE | 4.66 | - | |
104 | Phosphorylation | IGFHLQIYPDGKVNG EEEEEEECCCCCCCC | 5.15 | - | |
110 | N-linked_Glycosylation | IYPDGKVNGSHEANM ECCCCCCCCCCHHHH | 50.14 | UniProtKB CARBOHYD | |
110 | N-linked_Glycosylation | IYPDGKVNGSHEANM ECCCCCCCCCCHHHH | 50.14 | 2005884 | |
250 | Phosphorylation | IKPKIPLSAPRKNTN CCCCCCCCCCCCCCC | 30.76 | 24719451 | |
261 | Phosphorylation | KNTNSVKYRLKFRFG CCCCCCEEEEEEECC | 21.01 | 30631047 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
EGF_HUMAN | EGF | physical | 25241761 | |
MK01_HUMAN | MAPK1 | physical | 25241761 | |
FGFR4_HUMAN | FGFR4 | physical | 25241761 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
190330 | Trichomegaly (TCMGLY) | |||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...