UniProt ID | FGF23_HUMAN | |
---|---|---|
UniProt AC | Q9GZV9 | |
Protein Name | Fibroblast growth factor 23 | |
Gene Name | FGF23 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 251 | |
Subcellular Localization | Secreted . Secretion is dependent on O-glycosylation. | |
Protein Description | Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity). Acts directly on the parathyroid to decrease PTH secretion (By similarity). Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.. | |
Protein Sequence | MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Phosphorylation | TATARNSYHLQIHKN EECCCCCEEEEEECC | 15.31 | - | |
70 | Phosphorylation | GAPHQTIYSALMIRS CCCCCCCEEEEEEEC | 7.41 | - | |
71 | Phosphorylation | APHQTIYSALMIRSE CCCCCCEEEEEEECC | 15.86 | - | |
154 | Phosphorylation | PGMNPPPYSQFLSRR CCCCCCCHHHHHHHC | 22.37 | - | |
155 | Phosphorylation | GMNPPPYSQFLSRRN CCCCCCHHHHHHHCC | 21.89 | - | |
159 | Phosphorylation | PPYSQFLSRRNEIPL CCHHHHHHHCCCCCE | 30.40 | - | |
178 | O-linked_Glycosylation | TPIPRRHTRSAEDDS CCCCCCCCCCCCCCC | 25.22 | 66730811 | |
178 | Phosphorylation | TPIPRRHTRSAEDDS CCCCCCCCCCCCCCC | 25.22 | - | |
180 | Phosphorylation | IPRRHTRSAEDDSER CCCCCCCCCCCCCCC | 36.85 | - | |
207 | Phosphorylation | TPAPASCSQELPSAE CCCCCCCCCCCCCCC | 24.97 | - | |
212 | Phosphorylation | SCSQELPSAEDNSPM CCCCCCCCCCCCCCC | 57.84 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
180 | S | Phosphorylation | Kinase | FAM20C | Q8IXL6 | PSP |
180 | S | Phosphorylation | Kinase | FAM20C | Q5MJS3 | PSP |
207 | S | Phosphorylation | Kinase | FAM20C | Q5MJS3 | PSP |
212 | S | Phosphorylation | Kinase | FAM20C | Q5MJS3 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF23_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF23_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FGFR1_HUMAN | FGFR1 | physical | 22393163 |
loading...