FGF17_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FGF17_HUMAN
• UniProt AC: O60258
• Protein Name: Fibroblast growth factor 17
• Gene Name: FGF17
• Organism: Homo sapiens (Human).
• Sequence Length: 216
• Subcellular Localization: Secreted.
• Protein Description: Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development..
• Protein Sequence: MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	IREYQLYSRTSGKHV HHHHEEEECCCCCCE	37.36	24719451
104	Phosphorylation	VRIKGAESEKYICMN EEECCCCCCCEEEEC	38.56	26074081
107	Phosphorylation	KGAESEKYICMNKRG CCCCCCCEEEECCCC	8.70	26074081
137	N-linked_Glycosylation	TEIVLENNYTAFQNA EEEEEECCCEECHHC	26.59	UniProtKB CARBOHYD
216	Phosphorylation	TRRPQPLT------- CCCCCCCC-------	43.16	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FGF17_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FGF17_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FGF17_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of FGF17_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.