UniProt ID | FGF17_HUMAN | |
---|---|---|
UniProt AC | O60258 | |
Protein Name | Fibroblast growth factor 17 | |
Gene Name | FGF17 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 216 | |
Subcellular Localization | Secreted. | |
Protein Description | Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.. | |
Protein Sequence | MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
59 | Phosphorylation | IREYQLYSRTSGKHV HHHHEEEECCCCCCE | 37.36 | 24719451 | |
104 | Phosphorylation | VRIKGAESEKYICMN EEECCCCCCCEEEEC | 38.56 | 26074081 | |
107 | Phosphorylation | KGAESEKYICMNKRG CCCCCCCEEEECCCC | 8.70 | 26074081 | |
137 | N-linked_Glycosylation | TEIVLENNYTAFQNA EEEEEECCCEECHHC | 26.59 | UniProtKB CARBOHYD | |
216 | Phosphorylation | TRRPQPLT------- CCCCCCCC------- | 43.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGF17_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGF17_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGF17_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FGF17_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...