| UniProt ID | FGD2_MOUSE | |
|---|---|---|
| UniProt AC | Q8BY35 | |
| Protein Name | FYVE, RhoGEF and PH domain-containing protein 2 | |
| Gene Name | Fgd2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 655 | |
| Subcellular Localization | Cytoplasm . Nucleus . Early endosome . Early endosome membrane . Cell projection, ruffle membrane . Cytoplasm, cytoskeleton . Recruitment to the endosome and ruffle membrane requires the presence of phosphoinositides. | |
| Protein Description | Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate.. | |
| Protein Sequence | MERACEKQDSVCNLVAVFENNRTPGEAPGSHSLEDQPHSPEHQLSLSPEPWEAPPVKEALKSEFRPVSRTYLSSLKNKLSSGAWRRSCQPGVSPGPETQEPEEKRVVRELLETEQAYVARLHLLDQVFFQELLREAGRSKAFPEDVVKLIFSNISSIYRFHAQFFLPELQRRVDDWAATPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWMDKSQPFQEVVTRIQCSEASSSLTLQHHMLEPVQRIPRYELLLKEYVQKLPAQAPDLEDAQRALDMIFSAAQHSNAAIAEMERLQGLWDVYQRLGLEDDIVDPSNTLLREGPVLKISFRRSDPMERYLVLFNNMLLYCVPRVLQVGAQFQVRTRIDVAGMKVRELTDAEFPHSFLVSGKQRTLELQARSRDEMVSWMQACQAAIDQVEKRSETFKAAVQGPQGDTQEPKPQVEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCAKCSDYRAELKYDSNRPNRVCLTCYTFLTGNVLPQGKEDKRRGILEKEASAAPEQSLVCSFLQLIGDKCSRSLPRSWCVIPRDDPLVLYVYAAPQDTKAHTSIPLLGYQVISGPQGDPRVFQLQQSGQQYTFKAESVELQGRWVTAIKRAASGRTPEGPDEEDVSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 10 | Phosphorylation | RACEKQDSVCNLVAV CHHHHHCCCHHEEEE | 26.52 | 22817900 | |
| 32 | Phosphorylation | GEAPGSHSLEDQPHS CCCCCCCCCCCCCCC | 34.84 | 25159016 | |
| 39 | Phosphorylation | SLEDQPHSPEHQLSL CCCCCCCCCCCCCCC | 38.37 | 25159016 | |
| 45 | Phosphorylation | HSPEHQLSLSPEPWE CCCCCCCCCCCCCCC | 21.89 | 26026062 | |
| 47 | Phosphorylation | PEHQLSLSPEPWEAP CCCCCCCCCCCCCCC | 24.68 | 25159016 | |
| 73 | Phosphorylation | PVSRTYLSSLKNKLS CCCHHHHHHHHHHHC | 24.18 | 29176673 | |
| 74 | Phosphorylation | VSRTYLSSLKNKLSS CCHHHHHHHHHHHCC | 40.54 | 27180971 | |
| 93 | Phosphorylation | RSCQPGVSPGPETQE HCCCCCCCCCCCCCC | 30.01 | 30635358 | |
| 196 | Phosphorylation | LAPFLKMYSEYVKNF HHHHHHHHHHHHHHH | 9.21 | 28576409 | |
| 199 | Phosphorylation | FLKMYSEYVKNFERA HHHHHHHHHHHHHHH | 15.70 | 28576409 | |
| 212 | Phosphorylation | RAAELLATWMDKSQP HHHHHHHHHHCCCCC | 22.69 | - | |
| 217 | Phosphorylation | LATWMDKSQPFQEVV HHHHHCCCCCHHHHH | 38.53 | - | |
| 350 | Phosphorylation | LFNNMLLYCVPRVLQ HHHCHHHHHHHHHHH | 6.35 | - | |
| 539 | Phosphorylation | GILEKEASAAPEQSL CHHHHHHCCCHHHHH | 26.51 | 24719451 | |
| 559 | Phosphorylation | QLIGDKCSRSLPRSW HHHCHHHCCCCCCCE | 30.55 | 23737553 | |
| 561 | Phosphorylation | IGDKCSRSLPRSWCV HCHHHCCCCCCCEEE | 26.82 | 23737553 | |
| 644 | Phosphorylation | KRAASGRTPEGPDEE HHHHCCCCCCCCCCC | 29.26 | 19060867 | |
| 654 | Phosphorylation | GPDEEDVSD------ CCCCCCCCC------ | 50.34 | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGD2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGD2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGD2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FGD2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...