UniProt ID | FGD2_HUMAN | |
---|---|---|
UniProt AC | Q7Z6J4 | |
Protein Name | FYVE, RhoGEF and PH domain-containing protein 2 | |
Gene Name | FGD2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 655 | |
Subcellular Localization | Cytoplasm, cytoskeleton . Cytoplasm. Nucleus. Early endosome. Early endosome membrane. Cell projection, ruffle membrane. Recruitment to the endosome and ruffle membrane requires the presence of phosphoinositides.. | |
Protein Description | Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Activates JNK1 via CDC42 but not RAC1. Binds to phosphatidylinositol 4,5-bisphosphate, phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate (By similarity).. | |
Protein Sequence | MKGASEEKLASVSNLVTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHLLDQVFFQELLKTARSSKAFPEDVVRVIFSNISSIYQFHSQFFLPELQRRLDDWTANPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWTDKSPLFQEVLTRIQSSEASGSLTLQHHMLEPVQRIPRYELLLKEYIQKLPAQAPDQADAQKALDMIFSAAQHSNAAITEMERLQDLWEVYQRLGLEDDIVDPSNTLLREGPVLKISFRRNDPMERYLFLFNNMLLYCVPRVIQVGAQFQVRTRIDVAGMKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMISWMQAFQAAIDQIEKRNETFKAAAQGPEGDIQEQELQSEELGLRAPQWVRDKMVTMCMRCQEPFNALTRRRHHCRACGYVVCARCSDYRAELKYDDNRPNRVCLHCYAFLTGNVLPEAKEDKRRGILEKGSSATPDQSLMCSFLQLIGDKWGKSGPRGWCVIPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTVGPQGDPRVFQLQQSGQLYTFKAETEELKGRWVKAMERAASGWSPSWPNDGDLSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MKGASEEKLASV ---CCCCCHHHHHHH | 55.76 | - | |
11 | Phosphorylation | ASEEKLASVSNLVTV CCHHHHHHHHHHHHH | 36.19 | 28857561 | |
22 | Phosphorylation | LVTVFENSRTPEAAP HHHHHCCCCCCCCCC | 30.27 | 28348404 | |
24 | Phosphorylation | TVFENSRTPEAAPRG HHHCCCCCCCCCCCC | 25.87 | 28348404 | |
40 (in isoform 5) | Phosphorylation | - | 17.52 | 30631047 | |
48 | Phosphorylation | PECRPPESPGPREKT CCCCCCCCCCCCCCC | 40.71 | 30108239 | |
67 | Phosphorylation | AVGSEPRTVSRRYLN HCCCCCHHHHHHHHH | 33.28 | - | |
69 | Phosphorylation | GSEPRTVSRRYLNSL CCCCHHHHHHHHHHH | 15.49 | - | |
72 | Phosphorylation | PRTVSRRYLNSLKNK CHHHHHHHHHHHHHH | 14.77 | 25003641 | |
75 | Phosphorylation | VSRRYLNSLKNKLSS HHHHHHHHHHHHCCH | 37.82 | 25003641 | |
81 | Phosphorylation | NSLKNKLSSEAWRKS HHHHHHCCHHHHHHH | 27.95 | 30108239 | |
82 | Phosphorylation | SLKNKLSSEAWRKSC HHHHHCCHHHHHHHC | 41.59 | 30108239 | |
230 | Phosphorylation | VLTRIQSSEASGSLT HHHHHHCCCCCCCEE | 22.32 | - | |
235 | Phosphorylation | QSSEASGSLTLQHHM HCCCCCCCEEEEECC | 18.71 | 28857561 | |
237 | Phosphorylation | SEASGSLTLQHHMLE CCCCCCEEEEECCCC | 26.52 | 28857561 | |
304 | Phosphorylation | LQDLWEVYQRLGLED HHHHHHHHHHHCCCC | 4.03 | - | |
350 | Phosphorylation | LFNNMLLYCVPRVIQ HHHCHHHHHHHHHHH | 6.35 | 21945579 | |
395 | Phosphorylation | LVSGKQRTLELQARS ECCCCCCEEEHHHHC | 23.30 | - | |
549 | Phosphorylation | PDQSLMCSFLQLIGD CCHHHHHHHHHHHHH | 18.28 | - | |
561 | Phosphorylation | IGDKWGKSGPRGWCV HHHCCCCCCCCCEEE | 50.52 | - | |
654 | Phosphorylation | WPNDGDLSD------ CCCCCCCCC------ | 46.12 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FGD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FGD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FGD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TM239_HUMAN | TMEM239 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...