| UniProt ID | FETUB_MOUSE | |
|---|---|---|
| UniProt AC | Q9QXC1 | |
| Protein Name | Fetuin-B | |
| Gene Name | Fetub | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 388 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Protease inhibitor required for egg fertilization. Required to prevent premature zona pellucida hardening before fertilization, probably by inhibiting the protease activity of ASTL, a protease that mediates the cleavage of ZP2 and triggers zona pellucida hardening.. | |
| Protein Sequence | MGLLRLLVLCTLAACCMARSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 40 | N-linked_Glycosylation | PLHPLGCNDSEVLAV CCCCCCCCHHHHHHH | 54.78 | - | |
| 63 | Phosphorylation | NRDQKDGYMLSLNRV CCCCCCCEEEEECCH | 12.67 | 25367039 | |
| 66 | Phosphorylation | QKDGYMLSLNRVHDV CCCCEEEEECCHHHH | 13.68 | 25367039 | |
| 77 | Phosphorylation | VHDVREHYQEDMGSL HHHHHHHHHHHCHHH | 14.62 | 25367039 | |
| 83 | Phosphorylation | HYQEDMGSLFYLTLD HHHHHCHHHHHHHHH | 14.52 | 25367039 | |
| 86 | Phosphorylation | EDMGSLFYLTLDVLE HHCHHHHHHHHHHHH | 12.22 | 25367039 | |
| 88 | Phosphorylation | MGSLFYLTLDVLETD CHHHHHHHHHHHHHC | 14.99 | 25367039 | |
| 94 | Phosphorylation | LTLDVLETDCHVLSR HHHHHHHHCHHHHHH | 39.50 | 25367039 | |
| 100 | Phosphorylation | ETDCHVLSRKAQKDC HHCHHHHHHHHHCCC | 30.55 | 25367039 | |
| 139 | N-linked_Glycosylation | VLYLPAYNCTLRPVS EEEEECCCCEEEECC | 17.88 | 17330941 | |
| 292 | O-linked_Glycosylation | QKLPQKNTAPTSSPS CCCCCCCCCCCCCCC | 40.84 | - | |
| 295 | O-linked_Glycosylation | PQKNTAPTSSPSVTA CCCCCCCCCCCCCCC | 39.10 | - | |
| 321 | Phosphorylation | DDEKPEESKGGSPEE CCCCCCCCCCCCHHH | 34.63 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FETUB_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FETUB_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FETUB_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FETUB_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| N-linked Glycosylation | |
| Reference | PubMed |
| "Enhanced analysis of the mouse plasma proteome using cysteine-containing tryptic glycopeptides."; Bernhard O.K., Kapp E.A., Simpson R.J.; J. Proteome Res. 6:987-995(2007). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-139, AND MASSSPECTROMETRY. | |
