UniProt ID | FCN1_MOUSE | |
---|---|---|
UniProt AC | O70165 | |
Protein Name | Ficolin-1 | |
Gene Name | Fcn1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 334 | |
Subcellular Localization |
Secreted . Cell membrane Peripheral membrane protein Extracellular side . Found on the monocyte and granulocyte surface. |
|
Protein Description | Extracellular lectin functioning as a pattern-recognition receptor in innate immunity. Binds the sugar moieties of pathogen-associated molecular patterns (PAMPs) displayed on microbes and activates the lectin pathway of the complement system. May also activate monocytes through a G protein-coupled receptor, FFAR2, inducing the secretion of interleukin-8/IL-8. Binds preferentially to 9-O-acetylated 2-6-linked sialic acid derivatives and to various glycans containing sialic acid engaged in a 2-3 linkage (By similarity).. | |
Protein Sequence | MQWPTLWAFSGLLCLCPSQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGEPGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDWDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
234 | Phosphorylation | KYSSFQVSEEQEKYK EEECEECCHHHHHHE | 25.32 | 25338131 | |
255 | Phosphorylation | LEGTAGDSLTKHNNM HCCCCCCCCCCCCCC | 36.70 | - | |
257 | Phosphorylation | GTAGDSLTKHNNMSF CCCCCCCCCCCCCCC | 33.92 | - | |
261 | N-linked_Glycosylation | DSLTKHNNMSFTTHD CCCCCCCCCCCCCCC | 27.48 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCN1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCN1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCN1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FCN1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...