FCL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FCL1_ARATH
• UniProt AC: O49213
• Protein Name: GDP-L-fucose synthase 1
• Gene Name: GER1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 323
• Protein Description: Catalyzes the two-step NADP-dependent conversion of GDP-4-dehydro-6-deoxy-D-mannose to GDP-fucose, involving an epimerase and a reductase reaction. Not involved in the synthesis of GDP-L-galactose from GDP-D-manose..
• Protein Sequence: MAETIGSEVSSMSDKSAKIFVAGHRGLVGSAIVRKLQEQGFTNLVLKTHAELDLTRQADVESFFSQEKPVYVILAAAKVGGIHANNTYPADFIGVNLQIQTNVIHSAYEHGVKKLLFLGSSCIYPKFAPQPIPESALLTASLEPTNEWYAIAKIAGIKTCQAYRIQHGWDAISGMPTNLYGPNDNFHPENSHVLPALMRRFHEAKVNGAEEVVVWGTGSPLREFLHVDDLADACVFLLDRYSGLEHVNIGSGQEVTIRELAELVKEVVGFEGKLGWDCTKPDGTPRKLMDSSKLASLGWTPKVSLRDGLSQTYDWYLKNVCNR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAETIGSEV ------CCCCCCHHH	23.73	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FCL1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FCL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FCL1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of FCL1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.