| UniProt ID | FCER2_HUMAN | |
|---|---|---|
| UniProt AC | P06734 | |
| Protein Name | Low affinity immunoglobulin epsilon Fc receptor | |
| Gene Name | FCER2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 321 | |
| Subcellular Localization |
Cell membrane Single-pass type II membrane protein. Cell membrane Lipid-anchor. Secreted. Also exists as a soluble excreted form, sCD23. |
|
| Protein Description | Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).. | |
| Protein Sequence | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MEEGQYSEIEELPR -CCCCCCHHHHHCCH | 24.98 | 30108239 | |
| 17 | S-palmitoylation | EELPRRRCCRRGTQI HHCCHHCCCHHCCHH | 1.69 | 22615937 | |
| 18 | S-palmitoylation | ELPRRRCCRRGTQIV HCCHHCCCHHCCHHH | 2.93 | 22615937 | |
| 63 | N-linked_Glycosylation | LEERAARNVSQVSKN HHHHHHHHHHHHHHH | 32.82 | UniProtKB CARBOHYD | |
| 85 | Phosphorylation | QMAQKSQSTQISQEL HHHHHHHHHHHHHHH | 29.39 | 27251275 | |
| 86 | Phosphorylation | MAQKSQSTQISQELE HHHHHHHHHHHHHHH | 23.45 | 27251275 | |
| 89 | Phosphorylation | KSQSTQISQELEELR HHHHHHHHHHHHHHH | 14.05 | 27251275 | |
| 155 | O-linked_Glycosylation | LRMELQVSSGFVCNT HHHEEECCCCCCCCC | 16.28 | OGP | |
| 254 | Phosphorylation | PGEPTSRSQGEDCVM CCCCCCCCCCCCCEE | 42.16 | - | |
| 265 | Phosphorylation | DCVMMRGSGRWNDAF CCEEECCCCCCCCHH | 18.15 | - | |
| 314 | Phosphorylation | DPDGRLPTPSAPLHS CCCCCCCCCCCCCCC | 34.17 | - | |
| 314 | O-linked_Glycosylation | DPDGRLPTPSAPLHS CCCCCCCCCCCCCCC | 34.17 | OGP |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCER2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCER2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCER2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ATF7_HUMAN | ATF7 | physical | 25416956 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...