dbPTM

FBX31_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FBX31_MOUSE
UniProt AC	Q3TQF0
Protein Name	F-box only protein 31
Gene Name	Fbxo31
Organism	Mus musculus (Mouse).
Sequence Length	507
Subcellular Localization
Protein Description	Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. Specifically recognizes phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest (By similarity)..
Protein Sequence	MAVCARLCGVGPARGCRRRQQRRGPAETAAADSEADTDPEEERIEAGPARCSLLELPPELLVEIFASLPGTDLPSLAQVCSRFRRILHTDTIWRRRCREEYGVCENLRKLEITGVSCRDVYAKLLHRYRHILGLWQPDIGPYGGLLNVVVDGLFIIGWMYLPPHDPHVGDPMRFKPLFRIHLMERKSATVECMYGHKGPHNGHIQIVKRDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSHPDDLIKPGLFKGTYGSHGLEIVMLSFHGSRARGTKITGDPNIPAGQQTVEIDLQRRIQLPDVENLRNFNELSRIVLEVREQVRQEQEAGEGAAPPREPSAKAADGPPAKDGKEPGGGAEAAEQSASSGQGQPFVLPVGVSSRNEDYPRTCRLCFYGTGLIAGHGFTSPERTPGVFVLFDEDRFGFLWLELKSFSLYSRVQATFQNAAAPSPQAFDEMLRNIQSLTS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
28	Phosphorylation	QRRGPAETAAADSEA HHCCCCHHHHHCCCC	24.57	23984901
33	Phosphorylation	AETAAADSEADTDPE CHHHHHCCCCCCCHH	29.92	25521595
37	Phosphorylation	AADSEADTDPEEERI HHCCCCCCCHHHHHH	61.58	25521595
215	Ubiquitination	KRDEFSTKCNQTDHH ECCCCCCCCCCCCCC	29.95	22790023
264	Phosphorylation	LMKFIYTSQYDNCLT HHHHHHHHCCCCCCE	15.12	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
264	S	Phosphorylation	Kinase	ATM	Q62388	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FBX31_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FBX31_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of FBX31_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FBX31_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-33 AND THR-37, AND MASSSPECTROMETRY.	17242355 [Abstract]