UniProt ID | FBX16_HUMAN | |
---|---|---|
UniProt AC | Q8IX29 | |
Protein Name | F-box only protein 16 | |
Gene Name | FBXO16 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 292 | |
Subcellular Localization | ||
Protein Description | Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.. | |
Protein Sequence | MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Acetylation | MMAFAPPKNTDGPKM CCCCCCCCCCCCCCC | 72.00 | 19413330 | |
10 | Phosphorylation | AFAPPKNTDGPKMQT CCCCCCCCCCCCCCC | 48.75 | 19413330 | |
170 | Phosphorylation | LHITKPKTPPKDGFV HCCCCCCCCCCCCEE | 54.04 | 27966365 | |
197 | Phosphorylation | EEKQSPLSAFRSSSS HHHCCCHHHHHCHHH | 28.84 | 24719451 | |
255 | Phosphorylation | RRKRNQMTPDFSRQS HHHHHCCCCCHHHHC | 15.22 | 26074081 | |
259 | Phosphorylation | NQMTPDFSRQSHDKK HCCCCCHHHHCHHHH | 36.47 | 27794612 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FBX16_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FBX16_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FBX16_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FBX16_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-10, AND MASSSPECTROMETRY. |