FBSP1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FBSP1_DROME
• UniProt AC: Q9V6L9
• Protein Name: F-box/SPRY domain-containing protein 1
• Gene Name: Fsn
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 255
• Subcellular Localization: Cytoplasm . Nucleus . Cell junction, synapse . Cell projection, axon . Perikaryon . In mid- to late-stage oocytes, recruited to the pole plasm. This posterior distribution is not maintained in later developmental stages. Some cortical accumulation is
• Protein Description: Required in the presynaptic motoneuron to down-regulate the levels of wnd and restrain synaptic terminal growth at the neuromuscular junction (NMJ). Negatively regulates the localization of vas to the posterior pole of the oocyte. Involved in primordial germ cell formation..
• Protein Sequence: MVDPVAALCNYNVLEVIFSYLELDDLSHCSQVCKSWYHFLNDENSDVWRWHCLNKLPKESLKSDLLASVSTYKTKLRAYFHAWSPNDCSRNVYIKPNGFTLHRNPVAQSTDAARGKIGFRHGRHTWEVIWEGPLGTVAVIGISTKEAALQCHGYVALLGSDDQSWGWNLVENHLLHNGDMQGSYPLLNNAPKYQVGERIRVILDCEDNTLSFEKNYEFLGVAFRGLPDKKLYPTVSAVYGNTEVSMVYLGTPLDG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of FBSP1_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FBSP1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FBSP1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FBSP1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CUL1_DROME	Cul1	physical	20123973

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.