UniProt ID | FACE2_MOUSE | |
---|---|---|
UniProt AC | P57791 | |
Protein Name | CAAX prenyl protease 2 | |
Gene Name | Rce1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 329 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1 (By similarity).. | |
Protein Sequence | MAALGGDGLRLLSVSRPERQPESAALSGPGSGLCCWVSVFSCFSLACSYVGSLYVWKSELPRDHPAVIKRRSTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLTDGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCTGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGSIFVSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQKWPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCMLLERTGASETLLCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAALGGDGL ------CCCCCCCCE | 16.05 | - | |
13 | Phosphorylation | GDGLRLLSVSRPERQ CCCEEEEEECCCCCC | 23.73 | - | |
15 | Phosphorylation | GLRLLSVSRPERQPE CEEEEEECCCCCCCC | 38.45 | - | |
72 | Phosphorylation | PAVIKRRSTSVLVVS CCCCCCCCCEEEEEC | 29.12 | 21082442 | |
73 | Phosphorylation | AVIKRRSTSVLVVSS CCCCCCCCEEEEECC | 22.50 | 21082442 | |
74 | Phosphorylation | VIKRRSTSVLVVSSL CCCCCCCEEEEECCC | 18.07 | 21082442 | |
82 | Phosphorylation | VLVVSSLSPLCVLLW EEEECCCHHHHHHHH | 20.13 | 21082442 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FACE2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
48 | K | ubiquitylation |
| - |
48 | K | ubiquitylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FACE2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FACE2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...