UniProt ID | FABPH_MOUSE | |
---|---|---|
UniProt AC | P11404 | |
Protein Name | Fatty acid-binding protein, heart | |
Gene Name | Fabp3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 133 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.. | |
Protein Sequence | MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKNTEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTHGSVVSTRTYEKEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MADAFVGTW ------CCCCCCEEE | 19.48 | - | |
8 | Phosphorylation | MADAFVGTWKLVDSK CCCCCCEEEEECCCC | 17.71 | 23737553 | |
10 | Acetylation | DAFVGTWKLVDSKNF CCCCEEEEECCCCCH | 38.17 | 155519 | |
15 | Ubiquitination | TWKLVDSKNFDDYMK EEEECCCCCHHHHHH | 58.11 | 22790023 | |
20 | Phosphorylation | DSKNFDDYMKSLGVG CCCCHHHHHHHCCCC | 14.32 | - | |
22 | Ubiquitination | KNFDDYMKSLGVGFA CCHHHHHHHCCCCHH | 35.98 | 22790023 | |
23 | Phosphorylation | NFDDYMKSLGVGFAT CHHHHHHHCCCCHHH | 17.52 | 22817900 | |
30 | Phosphorylation | SLGVGFATRQVASMT HCCCCHHHHHHHCCC | 21.26 | 22817900 | |
38 | Ubiquitination | RQVASMTKPTTIIEK HHHHCCCCCEEEEEE | 31.55 | 22790023 | |
45 | Ubiquitination | KPTTIIEKNGDTITI CCEEEEEECCCEEEE | 56.68 | 22790023 | |
53 | Ubiquitination | NGDTITIKTQSTFKN CCCEEEEEECCEECC | 31.68 | 22790023 | |
82 | Ubiquitination | TADDRKVKSLVTLDG CCCCCEEEEEEEEEC | 40.90 | 22790023 | |
83 | Phosphorylation | ADDRKVKSLVTLDGG CCCCEEEEEEEEECC | 30.93 | - | |
91 | Ubiquitination | LVTLDGGKLIHVQKW EEEEECCEEEEEEEE | 50.20 | 22790023 | |
97 | Ubiquitination | GKLIHVQKWNGQETT CEEEEEEEECCCEEE | 41.35 | 22790023 | |
122 | Phosphorylation | ILTLTHGSVVSTRTY EEEEECCCEEEEEEE | 16.25 | 23737553 | |
125 | Phosphorylation | LTHGSVVSTRTYEKE EECCCEEEEEEEECC | 15.26 | 23737553 | |
126 | Phosphorylation | THGSVVSTRTYEKEA ECCCEEEEEEEECCC | 18.54 | 23737553 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
20 | Y | Phosphorylation | Kinase | TYR-KINASES | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FABPH_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FABPH_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FABPH_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...