| UniProt ID | FA89A_HUMAN | |
|---|---|---|
| UniProt AC | Q96GI7 | |
| Protein Name | Protein FAM89A | |
| Gene Name | FAM89A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 184 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSGARAAPGAAGNGAVRGLRVDGLPPLPKSLSGLLHSASGGGASGGWRHLERLYAQKSRIQDELSRGGPGGGGARAAALPAKPPNLDAALALLRKEMVGLRQLDMSLLCQLYSLYESIQEYKGACQAASSPDCTYALENGFFDEEEEYFQEQNSLHDRRDRGPPRDLSLPVSSLSSSDWILESI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGARAAPG ------CCCCCCCCC | 40.95 | - | |
| 30 | Phosphorylation | GLPPLPKSLSGLLHS CCCCCCCCHHHHCHH | 26.31 | 23186163 | |
| 32 | Phosphorylation | PPLPKSLSGLLHSAS CCCCCCHHHHCHHHC | 34.19 | 23186163 | |
| 39 | Phosphorylation | SGLLHSASGGGASGG HHHCHHHCCCCCCCH | 40.77 | 23186163 | |
| 57 | Ubiquitination | LERLYAQKSRIQDEL HHHHHHHHHHHHHHH | 33.26 | 27667366 | |
| 66 | Methylation | RIQDELSRGGPGGGG HHHHHHHHCCCCCCH | 67.71 | - | |
| 129 | Phosphorylation | KGACQAASSPDCTYA HCHHHHCCCCCCHHH | 45.48 | 23090842 | |
| 130 | Phosphorylation | GACQAASSPDCTYAL CHHHHCCCCCCHHHH | 21.74 | 23090842 | |
| 134 | Phosphorylation | AASSPDCTYALENGF HCCCCCCHHHHHCCC | 21.14 | 23090842 | |
| 135 | Phosphorylation | ASSPDCTYALENGFF CCCCCCHHHHHCCCC | 18.60 | 23090842 | |
| 154 | Phosphorylation | EYFQEQNSLHDRRDR HHHHHHHCCCCCCCC | 27.12 | - | |
| 168 | Phosphorylation | RGPPRDLSLPVSSLS CCCCCCCCCCHHHCC | 34.61 | 27251275 | |
| 183 | Phosphorylation | SSDWILESI------ CCCCHHHCC------ | 30.10 | 27251275 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA89A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA89A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA89A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FA89A_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
