FA84A_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FA84A_HUMAN
• UniProt AC: Q96KN4
• Protein Name: Protein FAM84A
• Gene Name: FAM84A
• Organism: Homo sapiens (Human).
• Sequence Length: 292
• Protein Sequence: MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQPAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
185 (in isoform 2)	Phosphorylation	-	14.74	-
186 (in isoform 2)	Phosphorylation	-	23.42	-
189 (in isoform 2)	Phosphorylation	-	16.46	-
213 (in isoform 2)	Phosphorylation	-	52.53	-
216 (in isoform 2)	Phosphorylation	-	14.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FA84A_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FA84A_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FA84A_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of FA84A_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.