dbPTM

FA81A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FA81A_MOUSE
UniProt AC	Q3UXZ6
Protein Name	Protein FAM81A
Gene Name	Fam81a
Organism	Mus musculus (Mouse).
Sequence Length	364
Subcellular Localization
Protein Description
Protein Sequence	MHLRRVKTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVSSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKSTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLSRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDHLSLIVKENSGANERDVEKKLSQMSARLDKIEESQKRNAEGQRKPDEEKVHGRISKLELQMTEDMKEMKAEVNAGFSAIYESIGSLRQVLEAKMKLDRDQLQKQIQQMQKPETAM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	VKTMPRHSQSLTMAP CCCCCCCCCCCCCCC	23.81	29899451
15	Phosphorylation	TMPRHSQSLTMAPYS CCCCCCCCCCCCCCC	28.90	29899451
57	Phosphorylation	RIKDDIVSSLQKMQN HCCHHHHHHHHHHHH	26.18	22324799
58	Phosphorylation	IKDDIVSSLQKMQNK CCHHHHHHHHHHHHC	24.75	20415495
116	Ubiquitination	YGTNSALKTLEMRQL CCCCHHHHHHHHHHH	51.27	22790023
124	Phosphorylation	TLEMRQLSGLGDLRG HHHHHHHCCCCCHHH	24.51	28059163
159	Ubiquitination	EGLQHLNKEQQAAKL HHHHHCCHHHHHHHH	64.36	22790023
173	Ubiquitination	LILETKIKDAEGQIS HHHHHHHCCCCHHHH	53.06	22790023
271	Phosphorylation	RDVEKKLSQMSARLD HHHHHHHHHHHHHHH	32.49	22324799
331	Phosphorylation	GFSAIYESIGSLRQV HHHHHHHHHHHHHHH	18.44	28576409

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FA81A_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FA81A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FA81A_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of FA81A_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FA81A_MOUSE

Related Literatures of Post-Translational Modification