UniProt ID | FA81A_HUMAN | |
---|---|---|
UniProt AC | Q8TBF8 | |
Protein Name | Protein FAM81A | |
Gene Name | FAM81A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 368 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MENMHLRRVRTMPRHSQSLTMAPYSSVSLVEQLEDRILCHEKTTAALVEHAFRIKDDIVNSLQKMQNKGGGDRLARLFLEEHIRNITAIVKQLNRDIEVLQEQIRARDNISYGTNSALKTLEMRQLSGLGDLRGRVARCDASIARLSAEHKTTYEGLQHLNKEQQAAKLILETKIKDAEGQISQLLNRVDLSISEQSTKLKMSHRDSNHQLQLLDTKFKGTVEELSNQILSARSWLQQEQERIEKELLQKIDQLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQLMQKPETPM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Ubiquitination | VEHAFRIKDDIVNSL HHHHHHCCHHHHHHH | 45.12 | 30230243 | |
64 | Acetylation | DIVNSLQKMQNKGGG HHHHHHHHHHHCCCH | 47.98 | 30588703 | |
119 | Ubiquitination | YGTNSALKTLEMRQL CCCCHHHHHHHHHHH | 51.27 | 21890473 | |
128 | Ubiquitination | LEMRQLSGLGDLRGR HHHHHHCCCCCHHHH | 42.12 | 21890473 | |
147 | Phosphorylation | DASIARLSAEHKTTY CHHHHHHCCHHCCHH | 26.51 | - | |
162 | Ubiquitination | EGLQHLNKEQQAAKL HHHHHCCHHHHHHHH | 64.36 | 29967540 | |
176 | Ubiquitination | LILETKIKDAEGQIS HHHHHHHCCCHHHHH | 53.06 | 30230243 | |
199 | Ubiquitination | SISEQSTKLKMSHRD CCCHHCCCCCCCCCC | 51.89 | 30230243 | |
219 | Ubiquitination | QLLDTKFKGTVEELS HHHHHHCCCHHHHHH | 56.05 | 30230243 | |
231 | Phosphorylation | ELSNQILSARSWLQQ HHHHHHHHHHHHHHH | 24.22 | 24719451 | |
262 | Phosphorylation | SLIVKENSGASERDM HHHHHCCCCCCHHHH | 36.51 | 29116813 | |
265 | Phosphorylation | VKENSGASERDMEKK HHCCCCCCHHHHHHH | 36.37 | 29116813 | |
274 | Phosphorylation | RDMEKKLSQMSARLD HHHHHHHHHHHHHHH | 32.49 | 29978859 | |
277 | Phosphorylation | EKKLSQMSARLDKIE HHHHHHHHHHHHHHH | 11.55 | 29978859 | |
338 | Phosphorylation | AVYESIGSLRQVLEA HHHHHHHHHHHHHHH | 20.78 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA81A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA81A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA81A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FA81A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...