UniProt ID | FA76A_MOUSE | |
---|---|---|
UniProt AC | Q922G2 | |
Protein Name | Protein FAM76A | |
Gene Name | Fam76a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 307 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKPCQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRGSHQEKEQYSRLSGGSHYNSQKTLSTSSIQNEIPKKKSKFESITTNGDSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQTRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGTITSP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
67 | Phosphorylation | QNVQLYGTPKPCQYC HHCHHHCCCCCCCCH | 18.00 | - | |
161 | Phosphorylation | HQEKEQYSRLSGGSH HHHHHHHHHHCCCCC | 26.83 | 25338131 | |
164 | Phosphorylation | KEQYSRLSGGSHYNS HHHHHHHCCCCCCCC | 39.74 | 28066266 | |
167 | Phosphorylation | YSRLSGGSHYNSQKT HHHHCCCCCCCCCCC | 26.73 | 28066266 | |
169 (in isoform 2) | Phosphorylation | - | 20.43 | 26643407 | |
171 (in isoform 2) | Phosphorylation | - | 26.36 | 26643407 | |
173 (in isoform 2) | Phosphorylation | - | 51.78 | 26824392 | |
174 | Phosphorylation | SHYNSQKTLSTSSIQ CCCCCCCCCCCHHHH | 20.50 | 25293948 | |
176 | Phosphorylation | YNSQKTLSTSSIQNE CCCCCCCCCHHHHHC | 31.32 | 25293948 | |
177 | Phosphorylation | NSQKTLSTSSIQNEI CCCCCCCCHHHHHCC | 29.61 | 25293948 | |
178 | Phosphorylation | SQKTLSTSSIQNEIP CCCCCCCHHHHHCCC | 23.28 | 25293948 | |
179 | Phosphorylation | QKTLSTSSIQNEIPK CCCCCCHHHHHCCCC | 28.43 | 25293948 | |
200 | Phosphorylation | SITTNGDSFSPDLAL CCCCCCCCCCCCCCC | 29.08 | 26745281 | |
202 | Phosphorylation | TTNGDSFSPDLALDS CCCCCCCCCCCCCCC | 22.81 | 26745281 | |
298 | Phosphorylation | ALSKSKKSEKSGTIT HHHHCCCCCCCCCCC | 54.73 | - | |
305 | Phosphorylation | SEKSGTITSP----- CCCCCCCCCC----- | 34.48 | 28066266 | |
306 | Phosphorylation | EKSGTITSP------ CCCCCCCCC------ | 25.43 | 28066266 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA76A_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA76A_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA76A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FA76A_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...