UniProt ID | FA72D_HUMAN | |
---|---|---|
UniProt AC | Q6L9T8 | |
Protein Name | Protein FAM72D | |
Gene Name | FAM72D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 149 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLLSCNNRHFWMFHSQAVYDINRLDSTGVNVLLRGNLPEIEESTDEDVLNISAEECIR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MSTNICSFKD -----CCCCCCCCHH | 27.57 | 30631047 | |
9 | Ubiquitination | STNICSFKDRCVSIL CCCCCCCHHHHHHHH | 28.15 | 33845483 | |
19 | Ubiquitination | CVSILCCKFCKQVLS HHHHHHHHHHHHHHH | 53.45 | - | |
22 | Ubiquitination | ILCCKFCKQVLSSRG HHHHHHHHHHHHCCC | 46.72 | 29967540 | |
27 | Phosphorylation | FCKQVLSSRGMKAVL HHHHHHHCCCCEEEE | 28.79 | 23532336 | |
63 | Ubiquitination | TGRCYFTKICKCKLK CCCEEEEEECCCCCC | 35.89 | - | |
70 | Ubiquitination | KICKCKLKDIACLKC EECCCCCCEEEEEEC | 32.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FA72D_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FA72D_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FA72D_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FA72D_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...