dbPTM

F168B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	F168B_HUMAN
UniProt AC	A1KXE4
Protein Name	Myelin-associated neurite-outgrowth inhibitor
Gene Name	FAM168B
Organism	Homo sapiens (Human).
Sequence Length	195
Subcellular Localization	Cytoplasm, perinuclear region. Cell membrane Multi-pass membrane protein. Cell projection, axon. Expressed in neuronal cell bodies and axonal fibers..
Protein Description	Modulates neuronal axonal outgrowth by acting as a negative regulator of CDC42 and STAT3 and a positive regulator of STMN2. Positive regulator of CDC27 (By similarity)..
Protein Sequence	MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNPVYSPG -------CCCCCCCC	13.27	19413330
5	Phosphorylation	---MNPVYSPGSSGV ---CCCCCCCCCCCC	15.48	22199227
6	Phosphorylation	--MNPVYSPGSSGVP --CCCCCCCCCCCCC	24.02	28355574
9	Phosphorylation	NPVYSPGSSGVPYAN CCCCCCCCCCCCCCC	27.57	22199227
10	Phosphorylation	PVYSPGSSGVPYANA CCCCCCCCCCCCCCC	50.12	22199227
14	Phosphorylation	PGSSGVPYANAKGIG CCCCCCCCCCCCCCC	15.30	20068231
37	Phosphorylation	YAAAAPAYSPNMYPG CEEECCCCCCCCCCC	24.49	28348404
38	Phosphorylation	AAAAPAYSPNMYPGA EEECCCCCCCCCCCC	16.35	28348404
42	Phosphorylation	PAYSPNMYPGANPTF CCCCCCCCCCCCCCC	12.73	28348404
46	N-linked_Glycosylation	PNMYPGANPTFQTGY CCCCCCCCCCCCCCC	41.90	-
57	Phosphorylation	QTGYTPGTPYKVSCS CCCCCCCCCEEEEEC	25.34	18847512
62	Phosphorylation	PGTPYKVSCSPTSGA CCCCEEEEECCCCCC	12.53	29978859
64	Phosphorylation	TPYKVSCSPTSGAVP CCEEEEECCCCCCCC	24.57	29978859
66	Phosphorylation	YKVSCSPTSGAVPPY EEEEECCCCCCCCCC	24.41	26074081
67	Phosphorylation	KVSCSPTSGAVPPYS EEEECCCCCCCCCCC	28.30	29978859
73	Phosphorylation	TSGAVPPYSSSPNPY CCCCCCCCCCCCCCC	18.34	29978859
74	Phosphorylation	SGAVPPYSSSPNPYQ CCCCCCCCCCCCCCC	30.07	26074081
75	Phosphorylation	GAVPPYSSSPNPYQT CCCCCCCCCCCCCCE	43.93	26074081
76	Phosphorylation	AVPPYSSSPNPYQTA CCCCCCCCCCCCCEE	23.82	26074081
80	Phosphorylation	YSSSPNPYQTAVYPV CCCCCCCCCEEEEEC	25.74	21552520
88	Methylation	QTAVYPVRSAYPQQS CEEEEECCCCCCCCC	15.86	-
163	Phosphorylation	MSAGTLLTAHSPTPV ECCCCEEEECCCCCC	25.99	26074081
166	Phosphorylation	GTLLTAHSPTPVAPH CCEEEECCCCCCCCC	28.18	26074081
168	Phosphorylation	LLTAHSPTPVAPHPV EEEECCCCCCCCCCC	33.15	26074081
185	Phosphorylation	PTYRAPGTPTYSYVP CCCCCCCCCCCCCCC	16.05	28796482
187	Phosphorylation	YRAPGTPTYSYVPPQ CCCCCCCCCCCCCCC	25.57	28796482
188	Phosphorylation	RAPGTPTYSYVPPQW CCCCCCCCCCCCCCC	10.14	28796482
189	Phosphorylation	APGTPTYSYVPPQW- CCCCCCCCCCCCCC-	23.33	28796482
190	Phosphorylation	PGTPTYSYVPPQW-- CCCCCCCCCCCCC--	13.43	28796482

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
57	T	Phosphorylation	Kinase	CDK2	P24941	PSP

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of F168B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of F168B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of F168B_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of F168B_HUMAN

Related Literatures of Post-Translational Modification

Acetylation
Reference	PubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY.	19413330 [Abstract]
Phosphorylation
Reference	PubMed
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-6, AND MASSSPECTROMETRY.	19369195 [Abstract]