UniProt ID | F153A_HUMAN | |
---|---|---|
UniProt AC | Q9UHL3 | |
Protein Name | Protein FAM153A | |
Gene Name | FAM153A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 310 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQCERDEGSLGKPLCPPEILSETLPGSVKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADAGTQTNGDLEDLEEHGPGQTVSEEATEVHTMEGDPDTLAEFLIRDVLQELSSYNGEEEDPEEVKTSLGVPQRGDLEDLEEHVPGQTVSEEATGVHMMQVDPATLAKSDLEDLEEHVPEQTVSEEATGVHMMQVDPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDIFNIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
26 | Phosphorylation | LRELHLYSTWKKYQE HHHHHHHHHHHHHHH | 33.87 | 27251275 | |
27 | Phosphorylation | RELHLYSTWKKYQEA HHHHHHHHHHHHHHH | 27.96 | 27251275 | |
37 | Phosphorylation | KYQEAMKTSLGVPQC HHHHHHHHHCCCCCC | 18.99 | 30257219 | |
64 | Phosphorylation | PPEILSETLPGSVKK CHHHHHCCCCCCCCC | 34.57 | - | |
155 | Phosphorylation | RDVLQELSSYNGEEE HHHHHHHHCCCCCCC | 29.98 | 30622161 | |
156 | Phosphorylation | DVLQELSSYNGEEED HHHHHHHCCCCCCCC | 34.93 | 30622161 | |
157 | Phosphorylation | VLQELSSYNGEEEDP HHHHHHCCCCCCCCH | 24.66 | 30622161 | |
211 | Phosphorylation | DPATLAKSDLEDLEE CHHHHCCCCHHHHHH | 41.65 | 22468782 | |
250 | Phosphorylation | AKQLEDSTITGSHQQ HHHHHHCCCCCCCCC | 34.57 | 22210691 | |
261 | Phosphorylation | SHQQMSASPSSAPAE CCCCCCCCCCCCCHH | 20.29 | 22210691 | |
274 | Phosphorylation | AEEATEKTKVEEEVK HHHHHHHHCHHHHHH | 33.81 | 22210691 | |
289 | Phosphorylation | TRKPKKKTRKPSKKS HCCCCCCCCCCCHHH | 53.45 | - | |
293 | Phosphorylation | KKKTRKPSKKSRWNV CCCCCCCCHHHHCHH | 56.61 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F153A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F153A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F153A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of F153A_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...