| UniProt ID | F107B_HUMAN | |
|---|---|---|
| UniProt AC | Q9H098 | |
| Protein Name | Protein FAM107B | |
| Gene Name | FAM107B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 131 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAEPDYIED ------CCCCCCCCC | 36.71 | 19413330 | |
| 6 | Phosphorylation | --MAEPDYIEDDNPE --CCCCCCCCCCCHH | 19.54 | 25394399 | |
| 25 | Acetylation | QKLINPVKTSRNHQD HHHCCCCCCCCCCHH | 41.88 | 25953088 | |
| 25 | Ubiquitination | QKLINPVKTSRNHQD HHHCCCCCCCCCCHH | 41.88 | 29967540 | |
| 26 | Phosphorylation | KLINPVKTSRNHQDL HHCCCCCCCCCCHHH | 32.90 | 29083192 | |
| 27 | Phosphorylation | LINPVKTSRNHQDLH HCCCCCCCCCCHHHH | 25.93 | 29083192 | |
| 42 | Acetylation | RELLMNQKRGLAPQN HHHHHHHHCCCCCCC | 43.35 | 25953088 | |
| 42 | Ubiquitination | RELLMNQKRGLAPQN HHHHHHHHCCCCCCC | 43.35 | 29967540 | |
| 43 | Methylation | ELLMNQKRGLAPQNK HHHHHHHCCCCCCCC | 35.28 | - | |
| 50 | Acetylation | RGLAPQNKPELQKVM CCCCCCCCHHHHHHH | 34.32 | 23749302 | |
| 50 | Ubiquitination | RGLAPQNKPELQKVM CCCCCCCCHHHHHHH | 34.32 | 33845483 | |
| 55 | Ubiquitination | QNKPELQKVMEKRKR CCCHHHHHHHHHHHH | 57.06 | 24816145 | |
| 64 | Ubiquitination | MEKRKRDQVIKQKEE HHHHHHHHHHHHHHH | 42.75 | 29967540 | |
| 68 (in isoform 2) | Phosphorylation | - | 47.47 | - | |
| 77 | Ubiquitination | EEEAQKKKSDLEIEL HHHHHHHHHHHHHHH | 57.12 | 33845483 | |
| 78 | Phosphorylation | EEAQKKKSDLEIELL HHHHHHHHHHHHHHH | 57.20 | 28450419 | |
| 81 | Ubiquitination | QKKKSDLEIELLKRQ HHHHHHHHHHHHHHH | 39.13 | 29967540 | |
| 86 | Ubiquitination | DLEIELLKRQQKLEQ HHHHHHHHHHHHHHH | 61.87 | 33845483 | |
| 89 | Ubiquitination | IELLKRQQKLEQLEL HHHHHHHHHHHHHHH | 57.23 | 33845483 | |
| 90 | Ubiquitination | ELLKRQQKLEQLELE HHHHHHHHHHHHHHH | 45.73 | 30230243 | |
| 94 | Ubiquitination | RQQKLEQLELEKQKL HHHHHHHHHHHHHHH | 6.23 | 24816145 | |
| 100 | Acetylation | QLELEKQKLQEEQEN HHHHHHHHHHHHHHH | 64.30 | 20167786 | |
| 100 | Ubiquitination | QLELEKQKLQEEQEN HHHHHHHHHHHHHHH | 64.30 | 33845483 | |
| 113 | Ubiquitination | ENAPEFVKVKGNLRR HHCCCHHHCCCHHHH | 43.48 | 33845483 | |
| 113 | Acetylation | ENAPEFVKVKGNLRR HHCCCHHHCCCHHHH | 43.48 | 26051181 | |
| 116 | Ubiquitination | PEFVKVKGNLRRTGQ CCHHHCCCHHHHHHH | 41.20 | 33845483 | |
| 121 | Phosphorylation | VKGNLRRTGQEVAQA CCCHHHHHHHHHHHH | 36.46 | 28674419 | |
| 125 | Ubiquitination | LRRTGQEVAQAQES- HHHHHHHHHHHHCC- | 3.53 | 33845483 | |
| 129 | Ubiquitination | GQEVAQAQES----- HHHHHHHHCC----- | 39.11 | 30230243 | |
| 131 | Phosphorylation | EVAQAQES------- HHHHHHCC------- | 33.18 | 28450419 | |
| 139 | Ubiquitination | --------------- --------------- | 33845483 | ||
| 152 | Ubiquitination | ---------------------------- ---------------------------- | 33845483 | ||
| 200 | Ubiquitination | ---------------------------------------------------------------------------- ---------------------------------------------------------------------------- | 29967540 | ||
| 217 | Ubiquitination | --------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------- | 29967540 | ||
| 225 | Ubiquitination | ----------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------- | 33845483 | ||
| 230 | Ubiquitination | ---------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------- | 24816145 | ||
| 252 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------- | 33845483 | ||
| 261 | Ubiquitination | ----------------------------------------------------------------------------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------- | 33845483 | ||
| 265 | Ubiquitination | --------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------- | 30230243 | ||
| 275 | Ubiquitination | ------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------- | 33845483 | ||
| 288 | Ubiquitination | -------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------- | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F107B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F107B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F107B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of F107B_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |