EXP12_ARATH - dbPTM
EXP12_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID EXP12_ARATH
UniProt AC Q9LDJ3
Protein Name Expansin-A12
Gene Name EXPA12
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 252
Subcellular Localization Secreted, cell wall. Membrane
Peripheral membrane protein.
Protein Description Causes loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found (By similarity)..
Protein Sequence MDMKGTYLVTVILLVSTLSVGMCSNGWIRAHATYYGVNDSPASLGGACGYDNPYHAGFGAHTAALSGELFRSGESCGGCYQVRCDFPADPKWCLRGAAVTVTATNFCPTNNNNGWCNLPRHHFDMSSPAFFRIARRGNEGIVPVFYRRVGCKRRGGVRFTMRGQGNFNMVMISNVGGGGSVRSVAVRGSKGKTWLQMTRNWGANWQSSGDLRGQRLSFKVTLTDSKTQTFLNVVPSSWWFGQTFSSRGRQFV
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of EXP12_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of EXP12_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of EXP12_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of EXP12_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of EXP12_ARATH !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of EXP12_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP